In a combination with a wallet size of 1 billion it should never be able to run out of money avoiding false-positives of some users who just wanted to test a strategy without actually checking how the stake_amount-variable should be used in combination with the strategy-function custom_stake_amount.
reason: some strategies demand a custom_stake_amount of 1$ demanding a very large wallet-size (which already was set previously)
Others start with 100% of a slot size and subdivide the base-orders and safety-orders down to finish at 100% of a slot-size and use unlimited stake_amount.
Edited docs to reflect that change.
In a combination with a wallet size of 1 billion it should never be able to run out of money avoiding false-positives of some users who just wanted to test a strategy without actually checking how the stake_amount-variable should be used in combination with the strategy-function custom_stake_amount
reason: some strategies demand a custom_stake_amount of 1$ demanding a very large wallet-size (which already was set previously)
Others start with 100% of a slot size and subdivide the base-orders and safety-orders down to finish at 100% of a slot-size and use unlimited stake_amount.
Edited docs to reflect that change too
There are some trade- and candle-related fields that are always available to output on the indicator-list so have updated the docs to include the most commonly used ones.
- moved doc from utils.md to lookahead-analysis.md and modified it (unfinished)
- added a check to automatically edit the config['backtest_cache'] to be 'none'
- adjusted test_lookahead_helper_export_to_csv to catch the new catching of errors
- adjusted test_lookahead_helper_text_table_lookahead_analysis_instances to catch the new catching of errors
- changed lookahead_analysis.start result-reporting to show that not enough trades were caught including x of y
moved doc from utils.md to lookahead-analysis.md and modified it (unfinished)
added a check to automatically edit the config['backtest_cache'] to be 'none'
Looking at has_bias should be enough to statisfy the test.
The tests could be extended with thecking the buy/sell signals and the dataframe itself -
but this should be sufficient for now.
There was a seeding error in SB3 after the gymnasium update, the stable baselines team has patched and fixed the issue, but the reset function has to be aligned.
switched from args to config (args still work)
renamed exportfilename to lookahead_analysis_exportfilename so if users decide to put something into it then it won't compete with other configurations
- optimized pairs for entry_varholder and exit_varholder to only check a single pair instead of all pairs.
- bias-check of freqai strategies now possible
- added condition to not crash when compared_df is empty (meaning no differences have been found)
open ended timeranges now work
if a file fails then it will not report as non-bias, but report in the table as error and the csv file will not have it listed.
removed args_common_optimize for strategy-updater
backtest_lookahead_bias_checker:
added args and cli-options for minimum and target trade amounts
fixed code according to best-practice coding requests of matthias (CamelCase etc)
While the actual problem is caused by a ccxt change, the change itself makes sense.
once ccxt starts returning the correct status (open) for create-orders, we can remove the fix.
closes#8079
before calling `git`. otherwise it would display git commit id from the
directory where you are calling `freqtrade` from instead of freqtrade's
current commit id
Changed logic to contain much less if conditions
currently still missing:
Webhook terminology, Telegram notification settings, Strategy/Config settings
Changed logic to contain much less if conditions
currently still missing:
Webhook terminology, Telegram notification settings, Strategy/Config settings
StrategyResolver.search_all_objects(enum_failed) set to False since we got no use in True
shortened update_code call
added modified_code8 test which currently still fails. (and thereby is commented out)
Improve the RL learning process by selecting random start point for the agent, it can help to block the agent to only learn on the selected period of time, while improving the quality of the model.
_update_total_profit() must be executed before "self._position = Positions.Neutral" because _update_total_profit() calls get_unrealized_profit(), which returns 0 if position is neutral and total_profit is not updated
* Allow use of --strategy-list with freqai, with warning
* ensure populate_any_indicators is identical for resused identifiers
* use pair instead of metadata["pair"]
Co-authored-by: robcaulk <rob.caulk@gmail.com>
Now that a recent bug regarding selling BNB is fixed, it should be safe to trade it, but with a warning that the user may have to manually maintain extra BNB.
Also the old text implied those features are always unabled so this texts makes it clear those fee-related features can be also disabled.
I'm not sure if it's still true that an "eaten by fees" position becomes unsellable but I left that as it is.
Apparently, cachetools is (intentionally) not threadsafe
when using the Caches directly.
It's therefore recommended to wrap these with an explicit lock to avoid
problems.
source: https://github.com/tkem/cachetools/issues/245closes#7215
Added two optional arguments for whitelist - `sorted` for alphabetical order and `nobase` for displaying the whitelist without base currency e.g. /USDT.
Updated help with optional commands.
Added a space in an unrelated help message.
plotting.py was missing a call to strategy.bot_loop_start() resulting in strategies using this callback to not work.
Made changes and confirmed plotting now works for strategies using bot_loop_start() callback.
LMK if anything else needed for PR.
1. Try to get points using `self.opt.ask` first
2. Discard the points that have already been evaluated
3. Retry using `self.opt.ask` up to 3 times
4. If still some points are missing in respect to `n_points`, random sample some points
5. Repeat until at least `n_points` points in the `asked_non_tried` list
6. Return a list with legth truncated at `n_points`
makes import of datetime columns more robust by first checking
if value is null because strftime can't handle NaT values
use `isnull()` because it handles all NaN/None/NaT cases
Ordering of Pairs without history should remain identical, so pairs with
positive performance move to the front, and negative pairs move to the back.
closes#4893
* updated new-config to add trading_mode and margin_mode
* added trading_mode and margin_mode to config examples
* added okex config example
* new file: config_examples/config_binance_futures.example.json
* removed trading_mode and margin_mode from base_config and binance and okex example
* deleted okex and futures config files
* updated full config file
* updated new-config command to add trading_mode and margin_mode to config
* new file: config_examples/config_okex_futures.example.json
* removed config_okex_futures.example.json
* added trading_mode to test_start_new_config
* new-config asks exchange before asking futures
* Simplify trading_mode selection
* margin_mode is empty string for spot new configs
* build_config_commands sorted exchanges
* isort
Co-authored-by: Matthias <xmatthias@outlook.com>
When specifying multiple pairs to download, the json filenames were
inconsistent due to the reassignment of candle_type. Also adds the
candle_type being downloaded to a log message.
Only KuCoin messages for 429000 error code are logged once.
Logs functions are also simplified and optimized.
test_remove_logs_for_pairs_already_in_blacklist is simplified as well.
New functions log_contains, num_log_contains, num_log_has and num_log_has_re
are introduced in the conftest module to help and simplify checking:
- if logs contain a string;
- count how many messages contain a string;
- count how many messages are the given string;
- count how many messages matchs a regex.
A couple of existing tests are changed using the new functions.
More logs are reduced, for KuCoin, on the retrier_async decorator:
_async_get_candle_history() returned exception
retrying _async_get_candle_history() still for
Giving up retrying: _async_get_candle_history()
Applying DDosProtection backoff delay
KuCoin APIs generate A LOT of error messages.
Consequently, logs are flooded with lines like:
2021-12-25 22:30:23 freqtrade.exchange.common: WARNING -
_async_get_candle_history() returned exception:
"kucoin GET https://openapi-v2.kucoin.com/api/v1/market/candles?
symbol=PDEX-USDT&type=5min&startAt=1640317818&endAt=1640467818
429 Too Many Requests {"code":"429000","msg":"Too Many Requests"}"
2021-12-25 22:30:23 freqtrade.exchange.common: WARNING -
retrying _async_get_candle_history() still for 3 times
2021-12-25 22:30:23 freqtrade.exchange.common: WARNING -
Kucoin 429 error, avoid triggering DDosProtection backoff delay.
2 tries left before giving up
2021-12-25 22:30:24 freqtrade.exchange.common: WARNING -
_async_get_candle_history() returned exception:
"kucoin GET https://openapi-v2.kucoin.com/api/v1/market/candles?
symbol=UBX-USDT&type=5min&startAt=1640317821&endAt=1640467821
429 Too Many Requests {"code":"429000","msg":"Too Many Requests"}"
Messages like:
Kucoin 429 error, avoid triggering DDosProtection backoff delay.
are logged only once for a certain period of time (default is 3600 seconds).
Travisci seems to no longer offer a free plan for open source
repositories, and other repositories report the need to get in touch
with support again and again.
This complication is not necessary with github actions, which covers our
CI needs well.
Every time that there's freqtrade "ticks", pairs in the blacklist are
checked and a warning message is displayed.
So, the logs are continuously flooded with the same warnings.
For example:
2021-07-26 06:24:45 freqtrade.plugins.pairlistmanager: WARNING -
Pair XTZUP/USDT in your blacklist. Removing it from whitelist...
2021-07-26 06:24:45 freqtrade.plugins.pairlistmanager: WARNING -
Pair SUSHIUP/USDT in your blacklist. Removing it from whitelist...
2021-07-26 06:24:45 freqtrade.plugins.pairlistmanager: WARNING -
Pair XTZDOWN/USDT in your blacklist. Removing it from whitelist...
2021-07-26 06:24:50 freqtrade.plugins.pairlistmanager: WARNING -
Pair XTZUP/USDT in your blacklist. Removing it from whitelist...
2021-07-26 06:24:50 freqtrade.plugins.pairlistmanager: WARNING -
Pair SUSHIUP/USDT in your blacklist. Removing it from whitelist...
2021-07-26 06:24:50 freqtrade.plugins.pairlistmanager: WARNING -
Pair XTZDOWN/USDT in your blacklist. Removing it from whitelist...
This patch shows the warning only the first time, by keeping track
of which pairs in the blacklist were already logged.
- Add warning that PrecisionFilter can't be used on backtest that use multiple strategies
- Add note that not all pairlist handlers can be used on backtest
The sentence I've changed was continued on a different paragraph before, even though they were connected ideas. I have changed it so that they are part of the same paragraph now.
/weekly now list weeks starting from monday instead of rolling weeks.
/monthly now list months starting from the 1st.
Signed-off-by: Antoine Merino <antoine.merino.dev@gmail.com>
/weekly now list weeks starting from monday instead of rolling weeks.
/monthly now list months starting from the 1st.
Signed-off-by: Antoine Merino <antoine.merino.dev@gmail.com>
## Summary
Fix very small mistake in docs, that might confuse people. Let me know if this is the correct value now, there is still another 3100 in there, which I think makes sense there and is correct.
## Quick changelog
Changed the `rateLimit` 3100 value to 200, to match the 200ms and thus 0.2s delay.
- introducing filter
- replaced get_all_locks with a query for speed
. removed logging in backtesting mode for speed
. replaced for-loop with map-function for speed
Changes to models.py:
- changed string representation of Pairlock to also contain reason and active-state
Close all file handles that are left dangling to avoid warnings such as
```
ResourceWarning: unclosed file <_io.TextIOWrapper
name='...' mode='r' encoding='UTF-8'> params = json_load(filename.open('r'))
```
added extra key daily_profit in return of optimize_reports.generate_daily_stats
this allows us to analyze and plot a daily profit chart / equity line using snippet below inside jupyter notebook
```
# Plotting equity line (starting with 0 on day 1 and adding daily profit for each backtested day)
from freqtrade.configuration import Configuration
from freqtrade.data.btanalysis import load_backtest_data, load_backtest_stats
import plotly.express as px
import pandas as pd
# strategy = 'Strat'
# config = Configuration.from_files(["user_data/config.json"])
# backtest_dir = config["user_data_dir"] / "backtest_results"
stats = load_backtest_stats(backtest_dir)
strategy_stats = stats['strategy'][strategy]
equity = 0
equity_daily = []
for dp in strategy_stats['daily_profit']:
equity_daily.append(equity)
equity += float(dp)
dates = pd.date_range(strategy_stats['backtest_start'], strategy_stats['backtest_end'])
df = pd.DataFrame({'dates':dates,'equity_daily':equity_daily})
fig = px.line(df, x="dates", y="equity_daily")
fig.show()
```
At the moment we can keep a single code path when using IntParameter, but we have to make a special hyperopt case for CategoricalParameter/DecimalParameter. Range property solves this.
- New features need to contain unit tests, must conform to PEP8 (max-line-length = 100) and should be documented with the introduction PR.
- PR's can be declared as `[WIP]` - which signify Work in Progress Pull Requests (which are not finished).
If you are unsure, discuss the feature on our [discord server](https://discord.gg/p7nuUNVfP7), on [Slack](https://join.slack.com/t/highfrequencybot/shared_invite/zt-mm786y93-Fxo37glxMY9g8OQC5AoOIw) or in a [issue](https://github.com/freqtrade/freqtrade/issues) before a PR.
If you are unsure, discuss the feature on our [discord server](https://discord.gg/p7nuUNVfP7) or in a [issue](https://github.com/freqtrade/freqtrade/issues) before a Pull Request.
Freqtrade is a free and open source crypto trading bot written in Python. It is designed to support all major exchanges and be controlled via Telegram. It contains backtesting, plotting and money management tools as well as strategy optimization by machine learning.
Freqtrade is a free and open source crypto trading bot written in Python. It is designed to support all major exchanges and be controlled via Telegram or webUI. It contains backtesting, plotting and money management tools as well as strategy optimization by machine learning.
@@ -26,50 +27,57 @@ hesitate to read the source code and understand the mechanism of this bot.
Please read the [exchange specific notes](docs/exchanges.md) to learn about eventual, special configurations needed for each exchange.
- [X] [Binance](https://www.binance.com/)
- [X] [Bittrex](https://bittrex.com/)
- [X] [Binance](https://www.binance.com/) ([*Note for binance users](docs/exchanges.md#blacklists))
- [X] [Gate.io](https://www.gate.io/ref/6266643)
- [X] [Huobi](http://huobi.com/)
- [X] [Kraken](https://kraken.com/)
- [X] [FTX](https://ftx.com)
- [X] [OKX](https://okx.com/) (Former OKEX)
- [ ] [potentially many others](https://github.com/ccxt/ccxt/). _(We cannot guarantee they will work)_
### Supported Futures Exchanges (experimental)
- [X] [Binance](https://www.binance.com/)
- [X] [Gate.io](https://www.gate.io/ref/6266643)
- [X] [OKX](https://okx.com/)
- [X] [Bybit](https://bybit.com/)
Please make sure to read the [exchange specific notes](docs/exchanges.md), as well as the [trading with leverage](docs/leverage.md) documentation before diving in.
### Community tested
Exchanges confirmed working by the community:
- [X] [Bitvavo](https://bitvavo.com/)
- [X] [Kucoin](https://www.kucoin.com/)
## Documentation
We invite you to read the bot documentation to ensure you understand how the bot is working.
Please find the complete documentation on our [website](https://www.freqtrade.io).
Please find the complete documentation on the [freqtrade website](https://www.freqtrade.io).
## Features
- [x]**Based on Python 3.7+**: For botting on any operating system - Windows, macOS and Linux.
- [x]**Based on Python 3.8+**: For botting on any operating system - Windows, macOS and Linux.
- [x]**Persistence**: Persistence is achieved through sqlite.
- [x]**Dry-run**: Run the bot without paying money.
- [x]**Backtesting**: Run a simulation of your buy/sell strategy.
- [x]**Strategy Optimization by machine learning**: Use machine learning to optimize your buy/sell strategy parameters with real exchange data.
- [x]**Edge position sizing** Calculate your win rate, risk reward ratio, the best stoploss and adjust your position size before taking a position for each specific market. [Learn more](https://www.freqtrade.io/en/latest/edge/).
- [X]**Adaptive prediction modeling**: Build a smart strategy with FreqAI that self-trains to the market via adaptive machine learning methods. [Learn more](https://www.freqtrade.io/en/stable/freqai/)
- [x]**Edge position sizing** Calculate your win rate, risk reward ratio, the best stoploss and adjust your position size before taking a position for each specific market. [Learn more](https://www.freqtrade.io/en/stable/edge/).
- [x]**Whitelist crypto-currencies**: Select which crypto-currency you want to trade or use dynamic whitelists.
- [x]**Blacklist crypto-currencies**: Select which crypto-currency you want to avoid.
- [x]**Builtin WebUI**: Builtin web UI to manage your bot.
- [x]**Manageable via Telegram**: Manage the bot with Telegram.
- [x]**Display profit/loss in fiat**: Display your profit/loss in 33 fiat.
- [x]**Daily summary of profit/loss**: Provide a daily summary of your profit/loss.
- [x]**Display profit/loss in fiat**: Display your profit/loss in fiat currency.
- [x]**Performance status report**: Provide a performance status of your current trades.
## Quick start
Freqtrade provides a Linux/macOS script to install all dependencies and help you to configure the bot.
Please refer to the [Docker Quickstart documentation](https://www.freqtrade.io/en/stable/docker_quickstart/) on how to get started quickly.
convert-data Convert candle (OHLCV) data from one format to
another.
convert-trade-data Convert trade data from one format to another.
list-data List downloaded data.
backtesting Backtesting module.
edge Edge module.
hyperopt Hyperopt module.
@@ -106,8 +114,10 @@ positional arguments:
list-timeframes Print available timeframes for the exchange.
show-trades Show trades.
test-pairlist Test your pairlist configuration.
install-ui Install FreqUI
plot-dataframe Plot candles with indicators.
plot-profit Generate plot showing profits.
webserver Webserver module.
optional arguments:
-h, --help show this help message and exit
@@ -117,14 +127,15 @@ optional arguments:
### Telegram RPC commands
Telegram is not mandatory. However, this is a great way to control your bot. More details and the full command list on our [documentation](https://www.freqtrade.io/en/latest/telegram-usage/)
Telegram is not mandatory. However, this is a great way to control your bot. More details and the full command list on the [documentation](https://www.freqtrade.io/en/latest/telegram-usage/)
-`/start`: Starts the trader.
-`/stop`: Stops the trader.
-`/stopbuy`: Stop entering new trades.
-`/stopentry`: Stop entering new trades.
-`/status <trade_id>|[table]`: Lists all or specific open trades.
-`/profit [<n>]`: Lists cumulative profit from all finished trades, over the last n days.
-`/forcesell <trade_id>|all`: Instantly sells the given trade (Ignoring `minimum_roi`).
-`/forceexit <trade_id>|all`: Instantly exits the given trade (Ignoring `minimum_roi`).
-`/fx <trade_id>|all`: Alias to `/forceexit`
-`/performance`: Show performance of each finished trade grouped by pair
-`/balance`: Show account balance per currency.
-`/daily <n>`: Shows profit or loss per day, over the last n days.
@@ -141,23 +152,23 @@ The project is currently setup in two main branches:
## Support
### Help / Discord / Slack
### Help / Discord
For any questions not covered by the documentation or for further information about the bot, or to simply engage with like-minded individuals, we encourage you to join our slack channel.
Please check out our [discord server](https://discord.gg/p7nuUNVfP7).
You can also join our [Slack channel](https://join.slack.com/t/highfrequencybot/shared_invite/zt-mm786y93-Fxo37glxMY9g8OQC5AoOIw).
For any questions not covered by the documentation or for further information about the bot, or to simply engage with like-minded individuals, we encourage you to join the Freqtrade [discord server](https://discord.gg/p7nuUNVfP7).
[search the issue tracker](https://github.com/freqtrade/freqtrade/issues?q=is%3Aissue)
first. If it hasn't been reported, please
[create a new issue](https://github.com/freqtrade/freqtrade/issues/new/choose) and
ensure you follow the template guide so that our team can assist you as
ensure you follow the template guide so that the team can assist you as
quickly as possible.
For every [issue](https://github.com/freqtrade/freqtrade/issues/new/choose) created, kindly follow up and mark satisfaction or reminder to close issue when equilibrium ground is reached.
to understand the requirements before sending your pull-requests.
Coding is not a necessity to contribute - maybe start with improving our documentation?
Coding is not a necessity to contribute - maybe start with improving the documentation?
Issues labeled [good first issue](https://github.com/freqtrade/freqtrade/labels/good%20first%20issue) can be good first contributions, and will help get you familiar with the codebase.
**Note** before starting any major new feature work, *please open an issue describing what you are planning to do* or talk to us on [discord](https://discord.gg/p7nuUNVfP7) or [Slack](https://join.slack.com/t/highfrequencybot/shared_invite/zt-mm786y93-Fxo37glxMY9g8OQC5AoOIw). This will ensure that interested parties can give valuable feedback on the feature, and let others know that you are working on it.
**Note** before starting any major new feature work, *please open an issue describing what you are planning to do* or talk to us on [discord](https://discord.gg/p7nuUNVfP7) (please use the #dev channel for this). This will ensure that interested parties can give valuable feedback on the feature, and let others know that you are working on it.
**Important:** Always create your PR against the `develop` branch, not `stable`.
@@ -188,7 +199,7 @@ Issues labeled [good first issue](https://github.com/freqtrade/freqtrade/labels/
The clock must be accurate, synchronized to a NTP server very frequently to avoid problems with communication to the exchanges.
### Min hardware required
### Minimum hardware required
To run this bot we recommend you a cloud instance with a minimum of:
@@ -196,9 +207,9 @@ To run this bot we recommend you a cloud instance with a minimum of:
* `trade_count`: Amount of trades (identical to `len(results)`)
* `min_date`: Start date of the timerange used
* `min_date`: End date of the timerange used
* `config`: Config object used (Note: Not all strategy-related parameters will be updated here if they are part of a hyperopt space).
* `processed`: Dict of Dataframes with the pair as keys containing the data used for backtesting.
* `backtest_stats`: Backtesting statistics using the same format as the backtesting file "strategy" substructure. Available fields can be seen in `generate_strategy_stats()` in `optimize_reports.py`.
This function needs to return a floating point number (`float`). Smaller numbers will be interpreted as better results. The parameters and balancing for this is up to you.
!!! Note
This function is called once per iteration - so please make sure to have this as optimized as possible to not slow hyperopt down unnecessarily.
This function is called once per epoch - so please make sure to have this as optimized as possible to not slow hyperopt down unnecessarily.
!!! Note
Please keep the arguments `*args` and `**kwargs` in the interface to allow us to extend this interface later.
!!! Note "`*args` and `**kwargs`"
Please keep the arguments `*args` and `**kwargs` in the interface to allow us to extend this interface in the future.
## Overriding pre-defined spaces
To override a pre-defined space (`roi_space`, `generate_roi_table`, `stoploss_space`, `trailing_space`), define a nested class called Hyperopt and define the required spaces as follows:
To override a pre-defined space (`roi_space`, `generate_roi_table`, `stoploss_space`, `trailing_space`, `max_open_trades_space`), define a nested class called Hyperopt and define the required spaces as follows:
```python
from freqtrade.optimize.space import Categorical, Dimension, Integer, SKDecimal
All overrides are optional and can be mixed/matched as necessary.
### Dynamic parameters
Parameters can also be defined dynamically, but must be available to the instance once the [`bot_start()` callback](strategy-callbacks.md#bot-start) has been called.
Possible values are either one of "GP", "RF", "ET", "GBRT" (Details can be found in the [scikit-optimize documentation](https://scikit-optimize.github.io/)), or "an instance of a class that inherits from `RegressorMixin` (from sklearn) and where the `predict` method has an optional `return_std` argument, which returns `std(Y | x)` along with `E[Y | x]`".
Some research will be necessary to find additional Regressors.
Example for `ExtraTreesRegressor` ("ET") with additional parameters:
# Corresponds to "ET" - but allows additional parameters.
return ExtraTreesRegressor(n_estimators=100)
```
The `dimensions` parameter is the list of `skopt.space.Dimension` objects corresponding to the parameters to be optimized. It can be used to create isotropic kernels for the `skopt.learning.GaussianProcessRegressor` estimator. Here's an example:
While custom estimators can be provided, it's up to you as User to do research on possible parameters and analyze / understand which ones should be used.
If you're unsure about this, best use one of the Defaults (`"ET"` has proven to be the most versatile) without further parameters.
## Space options
For the additional spaces, scikit-optimize (in combination with Freqtrade) provides the following space types:
Assuming the definition of a rather small space (`SKDecimal(0.10, 0.15, decimals=2, name='xxx')`) - SKDecimal will have 5 possibilities (`[0.10, 0.11, 0.12, 0.13, 0.14, 0.15]`).
A corresponding real space `Real(0.10, 0.15 name='xxx')` on the other hand has an almost unlimited number of possibilities (`[0.10, 0.010000000001, 0.010000000002, ... 0.014999999999, 0.01500000000]`).
---
## Legacy Hyperopt
This Section explains the configuration of an explicit Hyperopt file (separate to the strategy).
!!! Warning "Deprecated / legacy mode"
Since the 2021.4 release you no longer have to write a separate hyperopt class, but all strategies can be hyperopted.
Please read the [main hyperopt page](hyperopt.md) for more details.
### Prepare hyperopt file
Configuring an explicit hyperopt file is similar to writing your own strategy, and many tasks will be similar.
!!! Tip "About this page"
For this page, we will be using a fictional strategy called `AwesomeStrategy` - which will be optimized using the `AwesomeHyperopt` class.
#### Create a Custom Hyperopt File
The simplest way to get started is to use the following command, which will create a new hyperopt file from a template, which will be located under `user_data/hyperopts/AwesomeHyperopt.py`.
Let assume you want a hyperopt file `AwesomeHyperopt.py`:
``` bash
freqtrade new-hyperopt --hyperopt AwesomeHyperopt
```
#### Legacy Hyperopt checklist
Checklist on all tasks / possibilities in hyperopt
Depending on the space you want to optimize, only some of the below are required:
* fill `buy_strategy_generator` - for buy signal optimization
* fill `indicator_space` - for buy signal optimization
* fill `sell_strategy_generator` - for sell signal optimization
* fill `sell_indicator_space` - for sell signal optimization
!!! Note
`populate_indicators` needs to create all indicators any of thee spaces may use, otherwise hyperopt will not work.
Optional in hyperopt - can also be loaded from a strategy (recommended):
* `populate_indicators` - fallback to create indicators
* `populate_buy_trend` - fallback if not optimizing for buy space. should come from strategy
* `populate_sell_trend` - fallback if not optimizing for sell space. should come from strategy
!!! Note
You always have to provide a strategy to Hyperopt, even if your custom Hyperopt class contains all methods.
Assuming the optional methods are not in your hyperopt file, please use `--strategy AweSomeStrategy` which contains these methods so hyperopt can use these methods instead.
Rarely you may also need to override:
* `roi_space` - for custom ROI optimization (if you need the ranges for the ROI parameters in the optimization hyperspace that differ from default)
* `generate_roi_table` - for custom ROI optimization (if you need the ranges for the values in the ROI table that differ from default or the number of entries (steps) in the ROI table which differs from the default 4 steps)
* `stoploss_space` - for custom stoploss optimization (if you need the range for the stoploss parameter in the optimization hyperspace that differs from default)
* `trailing_space` - for custom trailing stop optimization (if you need the ranges for the trailing stop parameters in the optimization hyperspace that differ from default)
#### Defining a buy signal optimization
Let's say you are curious: should you use MACD crossings or lower Bollinger
Bands to trigger your buys. And you also wonder should you use RSI or ADX to
help with those buy decisions. If you decide to use RSI or ADX, which values
should I use for them? So let's use hyperparameter optimization to solve this
mystery.
We will start by defining a search space:
```python
def indicator_space() -> List[Dimension]:
"""
Define your Hyperopt space for searching strategy parameters
Hyperopt will now call `populate_buy_trend()` many times (`epochs`) with different value combinations.
It will use the given historical data and make buys based on the buy signals generated with the above function.
Based on the results, hyperopt will tell you which parameter combination produced the best results (based on the configured [loss function](#loss-functions)).
!!! Note
The above setup expects to find ADX, RSI and Bollinger Bands in the populated indicators.
When you want to test an indicator that isn't used by the bot currently, remember to
add it to the `populate_indicators()` method in your strategy or hyperopt file.
#### Sell optimization
Similar to the buy-signal above, sell-signals can also be optimized.
Place the corresponding settings into the following methods
* Inside `sell_indicator_space()` - the parameters hyperopt shall be optimizing.
* Within `sell_strategy_generator()` - populate the nested method `populate_sell_trend()` to apply the parameters.
The configuration and rules are the same than for buy signals.
To avoid naming collisions in the search-space, please prefix all sell-spaces with `sell-`.
### Execute Hyperopt
Once you have updated your hyperopt configuration you can run it.
Because hyperopt tries a lot of combinations to find the best parameters it will take time to get a good result. More time usually results in better results.
We strongly recommend to use `screen` or `tmux` to prevent any connection loss.
Use `<hyperoptname>` as the name of the custom hyperopt used.
The `-e` option will set how many evaluations hyperopt will do. Since hyperopt uses Bayesian search, running too many epochs at once may not produce greater results. Experience has shown that best results are usually not improving much after 500-1000 epochs.
Doing multiple runs (executions) with a few 1000 epochs and different random state will most likely produce different results.
The `--spaces all` option determines that all possible parameters should be optimized. Possibilities are listed below.
!!! Note
Hyperopt will store hyperopt results with the timestamp of the hyperopt start time.
Reading commands (`hyperopt-list`, `hyperopt-show`) can use `--hyperopt-filename <filename>` to read and display older hyperopt results.
You can find a list of filenames with `ls -l user_data/hyperopt_results/`.
#### Running Hyperopt using methods from a strategy
Hyperopt can reuse `populate_indicators`, `populate_buy_trend`, `populate_sell_trend` from your strategy, assuming these methods are **not** in your custom hyperopt file, and a strategy is provided.
Once the optimized parameters and conditions have been implemented into your strategy, you should backtest the strategy to make sure everything is working as expected.
To achieve same results (number of trades, their durations, profit, etc.) than during Hyperopt, please use same configuration and parameters (timerange, timeframe, ...) used for hyperopt `--dmmp`/`--disable-max-market-positions` and `--eps`/`--enable-position-stacking` for Backtesting.
Should results don't match, please double-check to make sure you transferred all conditions correctly.
Pay special care to the stoploss (and trailing stoploss) parameters, as these are often set in configuration files, which override changes to the strategy.
You should also carefully review the log of your backtest to ensure that there were no parameters inadvertently set by the configuration (like `stoploss` or `trailing_stop`).
### Sharing methods with your strategy
Hyperopt classes provide access to the Strategy via the `strategy` class attribute.
This can be a great way to reduce code duplication if used correctly, but will also complicate usage for inexperienced users.
``` python
from pandas import DataFrame
from freqtrade.strategy.interface import IStrategy
import freqtrade.vendor.qtpylib.indicators as qtpylib
For more information regarding usage of the sqlite databases, for example to manually enter or remove trades, please refer to the [SQL Cheatsheet](sql_cheatsheet.md).
### Multiple instances using docker
To run multiple instances of freqtrade using docker you will need to edit the docker-compose.yml file and add all the instances you want as separate services. Remember, you can separate your configuration into multiple files, so it's a good idea to think about making them modular, then if you need to edit something common to all bots, you can do that in a single config file.
``` yml
---
version: '3'
services:
freqtrade1:
image: freqtradeorg/freqtrade:stable
# image: freqtradeorg/freqtrade:develop
# Use plotting image
# image: freqtradeorg/freqtrade:develop_plot
# Build step - only needed when additional dependencies are needed
# build:
# context: .
# dockerfile: "./docker/Dockerfile.custom"
restart: always
container_name: freqtrade1
volumes:
- "./user_data:/freqtrade/user_data"
# Expose api on port 8080 (localhost only)
# Please read the https://www.freqtrade.io/en/latest/rest-api/ documentation
# before enabling this.
ports:
- "127.0.0.1:8080:8080"
# Default command used when running `docker compose up`
You can use whatever naming convention you want, freqtrade1 and 2 are arbitrary. Note, that you will need to use different database files, port mappings and telegram configurations for each instance, as mentioned above.
## Configure the bot running as a systemd service
Copy the `freqtrade.service` file to your systemd user directory (usually `~/.config/systemd/user`) and update `WorkingDirectory` and `ExecStart` to match your setup.
@@ -111,12 +176,15 @@ Log messages are send to `syslog` with the `user` facility. So you can see them
On many systems `syslog` (`rsyslog`) fetches data from `journald` (and vice versa), so both `--logfile syslog` or `--logfile journald` can be used and the messages be viewed with both `journalctl` and a syslog viewer utility. You can combine this in any way which suites you better.
For `rsyslog` the messages from the bot can be redirected into a separate dedicated log file. To achieve this, add
```
if $programname startswith "freqtrade" then -/var/log/freqtrade.log
```
to one of the rsyslog configuration files, for example at the end of the `/etc/rsyslog.d/50-default.conf`.
For `syslog` (`rsyslog`), the reduction mode can be switched on. This will reduce the number of repeating messages. For instance, multiple bot Heartbeat messages will be reduced to a single message when nothing else happens with the bot. To achieve this, set in `/etc/rsyslog.conf`:
```
# Filter duplicated messages
$RepeatedMsgReduction on
@@ -124,7 +192,7 @@ $RepeatedMsgReduction on
### Logging to journald
This needs the `systemd` python package installed as the dependency, which is not available on Windows. Hence, the whole journald logging functionality is not available for a bot running on Windows.
This needs the `cysystemd` python package installed as dependency (`pip install cysystemd`), which is not available on Windows. Hence, the whole journald logging functionality is not available for a bot running on Windows.
To send Freqtrade log messages to `journald` system service use the `--logfile` command line option with the value in the following format:
Show backtesting breakdown per [day, week, month].
--cache {none,day,week,month}
Load a cached backtest result no older than specified
age (default: day).
Common arguments:
-v, --verbose Verbose mode (-vv for more, -vvv to get all messages).
@@ -97,7 +107,7 @@ Strategy arguments:
## Test your strategy with Backtesting
Now you have good Buy and Sell strategies and some historic data, you want to test it against
Now you have good Entry and exit strategies and some historic data, you want to test it against
real data. This is what we call [backtesting](https://en.wikipedia.org/wiki/Backtesting).
Backtesting will use the crypto-currencies (pairs) from your config file and load historical candle (OHLCV) data from `user_data/data/<exchange>` by default.
@@ -109,7 +119,7 @@ The result of backtesting will confirm if your bot has better odds of making a p
All profit calculations include fees, and freqtrade will use the exchange's default fees for the calculation.
!!! Warning "Using dynamic pairlists for backtesting"
Using dynamic pairlists is possible, however it relies on the current market conditions - which will not reflect the historic status of the pairlist.
Using dynamic pairlists is possible (not all of the handlers are allowed to be used in backtest mode), however it relies on the current market conditions - which will not reflect the historic status of the pairlist.
Also, when using pairlists other than StaticPairlist, reproducibility of backtesting-results cannot be guaranteed.
Please read the [pairlists documentation](plugins.md#pairlists) for more information.
@@ -205,7 +215,7 @@ Sometimes your account has certain fee rebates (fee reductions starting with a c
To account for this in backtesting, you can use the `--fee` command line option to supply this value to backtesting.
This fee must be a ratio, and will be applied twice (once for trade entry, and once for trade exit).
For example, if the buying and selling commission fee is 0.1% (i.e., 0.001 written as ratio), then you would run backtesting as the following:
For example, if the commission fee per order is 0.1% (i.e., 0.001 written as ratio), then you would run backtesting as the following:
```bash
freqtrade backtesting --fee 0.001
@@ -242,79 +252,96 @@ The most important in the backtesting is to understand the result.
@@ -335,9 +362,9 @@ The column `Avg Profit %` shows the average profit for all trades made while the
The column `Tot Profit %` shows instead the total profit % in relation to the starting balance.
In the above results, we have a starting balance of 0.01 BTC and an absolute profit of 0.00762792 BTC - so the `Tot Profit %` will be `(0.00762792 / 0.01) * 100 ~= 76.2%`.
Your strategy performance is influenced by your buy strategy, your sell strategy, and also by the `minimal_roi` and `stop_loss` you have set.
Your strategy performance is influenced by your entry strategy, your exit strategy, and also by the `minimal_roi` and `stop_loss` you have set.
For example, if your `minimal_roi` is only `"0": 0.01` you cannot expect the bot to make more profit than 1% (because it will sell every time a trade reaches 1%).
For example, if your `minimal_roi` is only `"0": 0.01` you cannot expect the bot to make more profit than 1% (because it will exit every time a trade reaches 1%).
```json
"minimal_roi":{
@@ -349,14 +376,14 @@ On the other hand, if you set a too high `minimal_roi` like `"0": 0.55`
(55%), there is almost no chance that the bot will ever reach this profit.
Hence, keep in mind that your performance is an integral mix of all different elements of the strategy, your configuration, and the crypto-currency pairs you have set up.
### Sell reasons table
### Exit reasons table
The 2nd table contains a recap of sell reasons.
This table can tell you which area needs some additional work (e.g. all or many of the `sell_signal` trades are losses, so you should work on improving the sell signal, or consider disabling it).
The 2nd table contains a recap of exit reasons.
This table can tell you which area needs some additional work (e.g. all or many of the `exit_signal` trades are losses, so you should work on improving the exit signal, or consider disabling it).
### Left open trades table
The 3rd table contains all trades the bot had to `forcesell` at the end of the backtesting period to present you the full picture.
The 3rd table contains all trades the bot had to `force_exit` at the end of the backtesting period to present you the full picture.
This is necessary to simulate realistic behavior, since the backtest period has to end at some point, while realistically, you could leave the bot running forever.
These trades are also included in the first table, but are also shown separately in this table for clarity.
@@ -366,43 +393,60 @@ The last element of the backtest report is the summary metrics table.
It contains some useful key metrics about performance of your strategy on backtesting data.
@@ -413,6 +457,11 @@ It contains some useful key metrics about performance of your strategy on backte
-`Final balance`: Final balance - starting balance + absolute profit.
-`Absolute profit`: Profit made in stake currency.
-`Total profit %`: Total profit. Aligned to the `TOTAL` row's `Tot Profit %` from the first table. Calculated as `(End capital − Starting capital) / Starting capital`.
-`CAGR %`: Compound annual growth rate.
-`Sortino`: Annualized Sortino ratio.
-`Sharpe`: Annualized Sharpe ratio.
-`Calmar`: Annualized Calmar ratio.
-`Profit factor`: profit / loss.
-`Avg. stake amount`: Average stake amount, either `stake_amount` or the average when using dynamic stake amount.
-`Total trade volume`: Volume generated on the exchange to reach the above profit.
-`Best Pair` / `Worst Pair`: Best and worst performing pair, and it's corresponding `Cum Profit %`.
@@ -420,49 +469,147 @@ It contains some useful key metrics about performance of your strategy on backte
-`Best day` / `Worst day`: Best and worst day based on daily profit.
-`Days win/draw/lose`: Winning / Losing days (draws are usually days without closed trade).
-`Avg. Duration Winners` / `Avg. Duration Loser`: Average durations for winning and losing trades.
-`Zero Duration Trades`: A number of trades that completed within same candle as they opened and had `trailing_stop_loss` sell reason. A significant amount of such trades may indicate that strategy is exploiting trailing stoploss behavior in backtesting and produces unrealistic results.
-`Rejected Buy signals`: Buy signals that could not be acted upon due to max_open_trades being reached.
-`Max Consecutive Wins / Loss`: Maximum consecutive wins/losses in a row.
-`Rejected Entry signals`: Trade entry signals that could not be acted upon due to `max_open_trades` being reached.
-`Entry/Exit Timeouts`: Entry/exit orders which did not fill (only applicable if custom pricing is used).
-`Canceled Trade Entries`: Number of trades that have been canceled by user request via `adjust_entry_price`.
-`Canceled Entry Orders`: Number of entry orders that have been canceled by user request via `adjust_entry_price`.
-`Replaced Entry Orders`: Number of entry orders that have been replaced by user request via `adjust_entry_price`.
-`Min balance` / `Max balance`: Lowest and Highest Wallet balance during the backtest period.
-`Drawdown`: Maximum drawdown experienced. For example, the value of 50% means that from highest to subsequent lowest point, a 50% drop was experienced).
-`Max % of account underwater`: Maximum percentage your account has decreased from the top since the simulation started.
Calculated as the maximum of `(Max Balance - Current Balance) / (Max Balance)`.
-`Absolute Drawdown (Account)`: Maximum Account Drawdown experienced. Calculated as `(Absolute Drawdown) / (DrawdownHigh + startingBalance)`.
-`Drawdown`: Maximum, absolute drawdown experienced. Difference between Drawdown High and Subsequent Low point.
-`Drawdown high` / `Drawdown low`: Profit at the beginning and end of the largest drawdown period. A negative low value means initial capital lost.
-`Drawdown Start` / `Drawdown End`: Start and end datetime for this largest drawdown (can also be visualized via the `plot-dataframe` sub-command).
-`Market change`: Change of the market during the backtest period. Calculated as average of all pairs changes from the first to the last candle using the "close" column.
-`Long / Short`: Split long/short values (Only shown when short trades were made).
-`Total profit Long %` / `Absolute profit Long`: Profit long trades only (Only shown when short trades were made).
-`Total profit Short %` / `Absolute profit Short`: Profit short trades only (Only shown when short trades were made).
### Assumptions made by backtesting
### Daily / Weekly / Monthly breakdown
You can get an overview over daily / weekly or monthly results by using the `--breakdown <>` switch.
To visualize daily and weekly breakdowns, you can use the following:
``` bash
freqtrade backtesting --strategy MyAwesomeStrategy --breakdown day week
```
``` output
======================== DAY BREAKDOWN =========================
The output will show a table containing the realized absolute Profit (in stake currency) for the given timeperiod, as well as wins, draws and losses that materialized (closed) on this day. Below that there will be a second table for the summarized values of weeks indicated by the date of the closing Sunday. The same would apply to a monthly breakdown indicated by the last day of the month.
### Backtest result caching
To save time, by default backtest will reuse a cached result from within the last day when the backtested strategy and config match that of a previous backtest. To force a new backtest despite existing result for an identical run specify `--cache none` parameter.
!!! Warning
Caching is automatically disabled for open-ended timeranges (`--timerange 20210101-`), as freqtrade cannot ensure reliably that the underlying data didn't change. It can also use cached results where it shouldn't if the original backtest had missing data at the end, which was fixed by downloading more data.
In this instance, please use `--cache none` once to force a fresh backtest.
### Further backtest-result analysis
To further analyze your backtest results, you can [export the trades](#exporting-trades-to-file).
You can then load the trades to perform further analysis as shown in the [data analysis](data-analysis.md#backtesting) backtesting section.
## Assumptions made by backtesting
Since backtesting lacks some detailed information about what happens within a candle, it needs to take a few assumptions:
- Buys happen at open-price
- Exchange [trading limits](#trading-limits-in-backtesting) are respected
- Entries happen at open-price
- All orders are filled at the requested price (no slippage, no unfilled orders)
- Sell-signal sells happen at open-price of the consecutive candle
- Sell-signal is favored over Stoploss, because sell-signals are assumed to trigger on candle's open
- Exit-signal exits happen at open-price of the consecutive candle
- Exit-signal is favored over Stoploss, because exit-signals are assumed to trigger on candle's open
- ROI
- sells are compared to high - but the ROI value is used (e.g. ROI = 2%, high=5% - so the sell will be at 2%)
- sells are never "below the candle", so a ROI of 2% may result in a sell at 2.4% if low was at 2.4% profit
- Forcesells caused by `<N>=-1` ROI entries use low as sell value, unless N falls on the candle open (e.g. `120: -1` for 1h candles)
- Stoploss sells happen exactly at stoploss price, even if low was lower, but the loss will be `2 * fees` higher than the stoploss price
- Stoploss is evaluated before ROI within one candle. So you can often see more trades with the `stoploss` sell reason comparing to the results obtained with the same strategy in the Dry Run/Live Trade modes
- exits are compared to high - but the ROI value is used (e.g. ROI = 2%, high=5% - so the exit will be at 2%)
- exits are never "below the candle", so a ROI of 2% may result in a exit at 2.4% if low was at 2.4% profit
- ROI entries which came into effect on the triggering candle (e.g. `120: 0.02` for 1h candles, from `60: 0.05`) will use the candle's open as exit rate
- Force-exits caused by `<N>=-1` ROI entries use low as exit value, unless N falls on the candle open (e.g. `120: -1` for 1h candles)
- Stoploss exits happen exactly at stoploss price, even if low was lower, but the loss will be `2 * fees` higher than the stoploss price
- Stoploss is evaluated before ROI within one candle. So you can often see more trades with the `stoploss` exit reason comparing to the results obtained with the same strategy in the Dry Run/Live Trade modes
- Low happens before high for stoploss, protecting capital first
- Trailing stoploss
- Trailing Stoploss is only adjusted if it's below the candle's low (otherwise it would be triggered)
- On trade entry candles that trigger trailing stoploss, the "minimum offset" (`stop_positive_offset`) is assumed (instead of high) - and the stop is calculated from this point. This rule is NOT applicable to custom-stoploss scenarios, since there's no information about the stoploss logic available.
- High happens first - adjusting stoploss
- Low uses the adjusted stoploss (so sells with large high-low difference are backtested correctly)
- Low uses the adjusted stoploss (so exits with large high-low difference are backtested correctly)
- ROI applies before trailing-stop, ensuring profits are "top-capped" at ROI if both ROI and trailing stop applies
- Sell-reason does not explain if a trade was positive or negative, just what triggered the sell (this can look odd if negative ROI values are used)
- Exit-reason does not explain if a trade was positive or negative, just what triggered the exit (this can look odd if negative ROI values are used)
- Evaluation sequence (if multiple signals happen on the same candle)
- ROI (if not stoploss)
- Sell-signal
- Exit-signal
- Stoploss
- ROI
- Trailing stoploss
Taking these assumptions, backtesting tries to mirror real trading as closely as possible. However, backtesting will **never** replace running a strategy in dry-run mode.
Also, keep in mind that past results don't guarantee future success.
In addition to the above assumptions, strategy authors should carefully read the [Common Mistakes](strategy-customization.md#common-mistakes-when-developing-strategies) section, to avoid using data in backtesting which is not available in real market conditions.
### Further backtest-result analysis
### Trading limits in backtesting
To further analyze your backtest results, you can [export the trades](#exporting-trades-to-file).
You can then load the trades to perform further analysis as shown in our [data analysis](data-analysis.md#backtesting) backtesting section.
Exchanges have certain trading limits, like minimum (and maximum) base currency, or minimum/maximum stake (quote) currency.
These limits are usually listed in the exchange documentation as "trading rules" or similar and can be quite different between different pairs.
Backtesting (as well as live and dry-run) does honor these limits, and will ensure that a stoploss can be placed below this value - so the value will be slightly higher than what the exchange specifies.
Freqtrade has however no information about historic limits.
This can lead to situations where trading-limits are inflated by using a historic price, resulting in minimum amounts > 50$.
For example:
BTC minimum tradable amount is 0.001.
BTC trades at 22.000\$ today (0.001 BTC is related to this) - but the backtesting period includes prices as high as 50.000\$.
Today's minimum would be `0.001 * 22_000` - or 22\$.
However the limit could also be 50$ - based on `0.001 * 50_000` in some historic setting.
#### Trading precision limits
Most exchanges pose precision limits on both price and amounts, so you cannot buy 1.0020401 of a pair, or at a price of 1.24567123123.
Instead, these prices and amounts will be rounded or truncated (based on the exchange definition) to the defined trading precision.
The above values may for example be rounded to an amount of 1.002, and a price of 1.24567.
These precision values are based on current exchange limits (as described in the [above section](#trading-limits-in-backtesting)), as historic precision limits are not available.
## Improved backtest accuracy
One big limitation of backtesting is it's inability to know how prices moved intra-candle (was high before close, or viceversa?).
So assuming you run backtesting with a 1h timeframe, there will be 4 prices for that candle (Open, High, Low, Close).
While backtesting does take some assumptions (read above) about this - this can never be perfect, and will always be biased in one way or the other.
To mitigate this, freqtrade can use a lower (faster) timeframe to simulate intra-candle movements.
To utilize this, you can append `--timeframe-detail 5m` to your regular backtesting command.
This will load 1h data as well as 5m data for the timeframe. The strategy will be analyzed with the 1h timeframe, and Entry orders will only be placed at the main timeframe, however Order fills and exit signals will be evaluated at the 5m candle, simulating intra-candle movements.
All callback functions (`custom_exit()`, `custom_stoploss()`, ... ) will be running for each 5m candle once the trade is opened (so 12 times in the above example of 1h timeframe, and 5m detailed timeframe).
`--timeframe-detail` must be smaller than the original timeframe, otherwise backtesting will fail to start.
Obviously this will require more memory (5m data is bigger than 1h data), and will also impact runtime (depending on the amount of trades and trade durations).
Also, data must be available / downloaded already.
!!! Tip
You can use this function as the last part of strategy development, to ensure your strategy is not exploiting one of the [backtesting assumptions](#assumptions-made-by-backtesting). Strategies that perform similarly well with this mode have a good chance to perform well in dry/live modes too (although only forward-testing (dry-mode) can really confirm a strategy).
## Backtesting multiple strategies
@@ -482,11 +629,11 @@ There will be an additional table comparing win/losses of the different strategi
Detailed output for all strategies one after the other will be available, so make sure to scroll up to see the details per strategy.
@@ -7,41 +7,64 @@ This page provides you some basic concepts on how Freqtrade works and operates.
* **Strategy**: Your trading strategy, telling the bot what to do.
* **Trade**: Open position.
* **Open Order**: Order which is currently placed on the exchange, and is not yet complete.
* **Pair**: Tradable pair, usually in the format of Quote/Base (e.g. XRP/USDT).
* **Pair**: Tradable pair, usually in the format of Base/Quote (e.g. `XRP/USDT` for spot, `XRP/USDT:USDT` for futures).
* **Timeframe**: Candle length to use (e.g. `"5m"`, `"1h"`, ...).
* **Indicators**: Technical indicators (SMA, EMA, RSI, ...).
* **Limit order**: Limit orders which execute at the defined limit price or better.
* **Market order**: Guaranteed to fill, may move price depending on the order size.
* **Current Profit**: Currently pending (unrealized) profit for this trade. This is mainly used throughout the bot and UI.
* **Realized Profit**: Already realized profit. Only relevant in combination with [partial exits](strategy-callbacks.md#adjust-trade-position) - which also explains the calculation logic for this.
* **Total Profit**: Combined realized and unrealized profit. The relative number (%) is calculated against the total investment in this trade.
## Fee handling
All profit calculations of Freqtrade include fees. For Backtesting / Hyperopt / Dry-run modes, the exchange default fee is used (lowest tier on the exchange). For live operations, fees are used as applied by the exchange (this includes BNB rebates etc.).
## Pair naming
Freqtrade follows the [ccxt naming convention](https://docs.ccxt.com/#/README?id=consistency-of-base-and-quote-currencies) for currencies.
Using the wrong naming convention in the wrong market will usually result in the bot not recognizing the pair, usually resulting in errors like "this pair is not available".
### Spot pair naming
For spot pairs, naming will be `base/quote` (e.g. `ETH/USDT`).
### Futures pair naming
For futures pairs, naming will be `base/quote:settle` (e.g. `ETH/USDT:USDT`).
## Bot execution logic
Starting freqtrade in dry-run or live mode (using `freqtrade trade`) will start the bot and start the bot iteration loop.
By default, loop runs every few seconds (`internals.process_throttle_secs`) and does roughly the following in the following sequence:
This will also run the `bot_start()` callback.
By default, the bot loop runs every few seconds (`internals.process_throttle_secs`) and performs the following actions:
* Fetch open trades from persistence.
* Calculate current list of tradable pairs.
* Download ohlcv data for the pairlist including all [informative pairs](strategy-customization.md#get-data-for-non-tradeable-pairs)
* Download OHLCV data for the pairlist including all [informative pairs](strategy-customization.md#get-data-for-non-tradeable-pairs)
This step is only executed once per Candle to avoid unnecessary network traffic.
* Call `bot_loop_start()` strategy callback.
* Analyze strategy per pair.
* Call `populate_indicators()`
* Call `populate_buy_trend()`
* Call `populate_sell_trend()`
* Call `populate_entry_trend()`
* Call `populate_exit_trend()`
* Check timeouts for open orders.
* Calls `check_buy_timeout()` strategy callback for open buy orders.
* Calls `check_sell_timeout()` strategy callback for open sell orders.
*Verifies existing positions and eventually places sell orders.
*Considers stoploss, ROI and sell-signal.
*Determine sell-price based on `ask_strategy` configuration setting.
*Before a sell order is placed, `confirm_trade_exit()` strategy callback is called.
* Calls `check_entry_timeout()` strategy callback for open entry orders.
* Calls `check_exit_timeout()` strategy callback for open exit orders.
*Calls `adjust_entry_price()` strategy callback for open entry orders.
*Verifies existing positions and eventually places exit orders.
*Considers stoploss, ROI and exit-signal, `custom_exit()` and `custom_stoploss()`.
*Determine exit-price based on `exit_pricing` configuration setting or by using the `custom_exit_price()` callback.
* Before a exit order is placed, `confirm_trade_exit()` strategy callback is called.
* Check position adjustments for open trades if enabled by calling `adjust_trade_position()` and place additional order if required.
* Check if trade-slots are still available (if `max_open_trades` is reached).
* Verifies buy signal trying to enter new positions.
* Determine buy-price based on `bid_strategy` configuration setting.
*Before a buy order is placed, `confirm_trade_entry()` strategy callback is called.
* Verifies entry signal trying to enter new positions.
* Determine entry-price based on `entry_pricing` configuration setting, or by using the `custom_entry_price()` callback.
*In Margin and Futures mode, `leverage()` strategy callback is called to determine the desired leverage.
* Determine stake size by calling the `custom_stake_amount()` callback.
* Before an entry order is placed, `confirm_trade_entry()` strategy callback is called.
This loop will be repeated again and again until the bot is stopped.
@@ -50,12 +73,26 @@ This loop will be repeated again and again until the bot is stopped.
[backtesting](backtesting.md) or [hyperopt](hyperopt.md) do only part of the above logic, since most of the trading operations are fully simulated.
* Load historic data for configured pairlist.
* Calls `bot_loop_start()` once.
* Calls `bot_start()` once.
* Calculate indicators (calls `populate_indicators()` once per pair).
* Calculate buy / sell signals (calls `populate_buy_trend()` and `populate_sell_trend()` once per pair)
* Confirm trade buy / sell (calls `confirm_trade_entry()` and `confirm_trade_exit()` if implemented in the strategy)
* Calculate entry / exit signals (calls `populate_entry_trend()` and `populate_exit_trend()` once per pair).
* Loops per candle simulating entry and exit points.
* Calls `bot_loop_start()` strategy callback.
* Check for Order timeouts, either via the `unfilledtimeout` configuration, or via `check_entry_timeout()` / `check_exit_timeout()` strategy callbacks.
* Calls `adjust_entry_price()` strategy callback for open entry orders.
* Check for trade entry signals (`enter_long` / `enter_short` columns).
* Confirm trade entry / exits (calls `confirm_trade_entry()` and `confirm_trade_exit()` if implemented in the strategy).
* Call `custom_entry_price()` (if implemented in the strategy) to determine entry price (Prices are moved to be within the opening candle).
* In Margin and Futures mode, `leverage()` strategy callback is called to determine the desired leverage.
* Determine stake size by calling the `custom_stake_amount()` callback.
* Check position adjustments for open trades if enabled and call `adjust_trade_position()` to determine if an additional order is requested.
* Call `custom_stoploss()` and `custom_exit()` to find custom exit points.
* For exits based on exit-signal, custom-exit and partial exits: Call `custom_exit_price()` to determine exit price (Prices are moved to be within the closing candle).
* Generate backtest report output
!!! Note
Both Backtesting and Hyperopt include exchange default Fees in the calculation. Custom fees can be passed to backtesting / hyperopt by specifying the `--fee` argument.
!!! Warning "Callback call frequency"
Backtesting will call each callback at max. once per candle (`--timeframe-detail` modifies this behavior to once per detailed candle).
Most callbacks will be called once per iteration in live (usually every ~5s) - which can cause backtesting mismatches.
This page explains the different parameters of the bot and how to run it.
!!! Note
If you've used `setup.sh`, don't forget to activate your virtual environment (`source .env/bin/activate`) before running freqtrade commands.
If you've used `setup.sh`, don't forget to activate your virtual environment (`source .venv/bin/activate`) before running freqtrade commands.
!!! Warning "Up-to-date clock"
The clock on the system running the bot must be accurate, synchronized to a NTP server frequently enough to avoid problems with communication to the exchanges.
@@ -12,22 +12,22 @@ This page explains the different parameters of the bot and how to run it.
@@ -5,148 +5,264 @@ By default, these settings are configured via the configuration file (see below)
## The Freqtrade configuration file
The bot uses a set of configuration parameters during its operation that all together conform the bot configuration. It normally reads its configuration from a file (Freqtrade configuration file).
The bot uses a set of configuration parameters during its operation that all together conform to the bot configuration. It normally reads its configuration from a file (Freqtrade configuration file).
Per default, the bot loads the configuration from the `config.json` file, located in the current working directory.
You can specify a different configuration file used by the bot with the `-c/--config` commandline option.
You can specify a different configuration file used by the bot with the `-c/--config` command-line option.
Multiple configuration files can be specified and used by the bot or the bot can read its configuration parameters from the process standard input stream.
!!! Tip "Use multiple configuration files to keep secrets secret"
You can use a 2nd configuration file containing your secrets. That way you can share your "primary" configuration file, while still keeping your API keys for yourself.
The 2nd file should only specify what you intend to override.
If a key is in more than one of the configurations, then the "last specified configuration" wins (in the above example, `config-private.json`).
If you used the [Quick start](installation.md/#quick-start) method for installing
If you used the [Quick start](docker_quickstart.md#docker-quick-start) method for installing
the bot, the installation script should have already created the default configuration file (`config.json`) for you.
If default configuration file is not created we recommend you to use `freqtrade new-config --config config.json` to generate a basic configuration file.
If the default configuration file is not created we recommend to use `freqtrade new-config --config config.json` to generate a basic configuration file.
The Freqtrade configuration file is to be written in the JSON format.
The Freqtrade configuration file is to be written in JSON format.
Additionally to the standard JSON syntax, you may use one-line `// ...` and multi-line `/* ... */` comments in your configuration files and trailing commas in the lists of parameters.
Do not worry if you are not familiar with JSON format -- simply open the configuration file with an editor of your choice, make some changes to the parameters you need, save your changes and, finally, restart the bot or, if it was previously stopped, run it again with the changes you made to the configuration. The bot validates syntax of the configuration file at startup and will warn you if you made any errors editing it, pointing out problematic lines.
Do not worry if you are not familiar with JSON format -- simply open the configuration file with an editor of your choice, make some changes to the parameters you need, save your changes and, finally, restart the bot or, if it was previously stopped, run it again with the changes you made to the configuration. The bot validates the syntax of the configuration file at startup and will warn you if you made any errors editing it, pointing out problematic lines.
### Environment variables
Set options in the Freqtrade configuration via environment variables.
This takes priority over the corresponding value in configuration or strategy.
Environment variables must be prefixed with `FREQTRADE__` to be loaded to the freqtrade configuration.
`__` serves as level separator, so the format used should correspond to `FREQTRADE__{section}__{key}`.
As such - an environment variable defined as `export FREQTRADE__STAKE_AMOUNT=200` would result in `{stake_amount: 200}`.
A more complex example might be `export FREQTRADE__EXCHANGE__KEY=<yourExchangeKey>` to keep your exchange key secret. This will move the value to the `exchange.key` section of the configuration.
Using this scheme, all configuration settings will also be available as environment variables.
Please note that Environment variables will overwrite corresponding settings in your configuration, but command line Arguments will always win.
Common example:
```
FREQTRADE__TELEGRAM__CHAT_ID=<telegramchatid>
FREQTRADE__TELEGRAM__TOKEN=<telegramToken>
FREQTRADE__EXCHANGE__KEY=<yourExchangeKey>
FREQTRADE__EXCHANGE__SECRET=<yourExchangeSecret>
```
!!! Note
Environment variables detected are logged at startup - so if you can't find why a value is not what you think it should be based on the configuration, make sure it's not loaded from an environment variable.
### Multiple configuration files
Multiple configuration files can be specified and used by the bot or the bot can read its configuration parameters from the process standard input stream.
You can specify additional configuration files in `add_config_files`. Files specified in this parameter will be loaded and merged with the initial config file. The files are resolved relative to the initial configuration file.
This is similar to using multiple `--config` parameters, but simpler in usage as you don't have to specify all files for all commands.
!!! Tip "Use multiple configuration files to keep secrets secret"
You can use a 2nd configuration file containing your secrets. That way you can share your "primary" configuration file, while still keeping your API keys for yourself.
The 2nd file should only specify what you intend to override.
If a key is in more than one of the configurations, then the "last specified configuration" wins (in the above example, `config-private.json`).
For one-off commands, you can also use the below syntax by specifying multiple "--config" parameters.
If the same configuration setting takes place in both `config.json` and `config-import.json`, then the parent configuration wins.
In the below case, `max_open_trades` would be 3 after the merging - as the reusable "import" configuration has this key overwritten.
``` json title="user_data/config.json"
{
"max_open_trades": 3,
"stake_currency": "USDT",
"add_config_files": [
"config-import.json"
]
}
```
``` json title="user_data/config-import.json"
{
"max_open_trades": 10,
"stake_amount": "unlimited",
}
```
Resulting combined configuration:
``` json title="Result"
{
"max_open_trades": 3,
"stake_currency": "USDT",
"stake_amount": "unlimited"
}
```
If multiple files are in the `add_config_files` section, then they will be assumed to be at identical levels, having the last occurrence override the earlier config (unless a parent already defined such a key).
## Configuration parameters
The table below will list all configuration parameters available.
Freqtrade can also load many options via command line (CLI) arguments (check out the commands `--help` output for details).
The prevelance for all Options is as follows:
### Configuration option prevalence
The prevalence for all Options is as follows:
- CLI arguments override any other option
- Configuration files are used in sequence (last file wins), and override Strategy configurations.
- Strategy configurations are only used if they are not set via configuration or via command line arguments. These options are marked with [Strategy Override](#parameters-in-the-strategy) in the below table.
- [Environment Variables](#environment-variables)
- Configuration files are used in sequence (the last file wins) and override Strategy configurations.
- Strategy configurations are only used if they are not set via configuration or command-line arguments. These options are marked with [Strategy Override](#parameters-in-the-strategy) in the below table.
### Parameters table
Mandatory parameters are marked as **Required**, which means that they are required to be set in one of the possible ways.
| Parameter | Description |
|------------|-------------|
| `max_open_trades` | **Required.** Number of open trades your bot is allowed to have. Only one open trade per pair is possible, so the length of your pairlist is another limitation which can apply. If -1 then it is ignored (i.e. potentially unlimited open trades, limited by the pairlist). [More information below](#configuring-amount-per-trade).<br> **Datatype:** Positive integer or -1.
| `max_open_trades` | **Required.** Number of open trades your bot is allowed to have. Only one open trade per pair is possible, so the length of your pairlist is another limitation that can apply. If -1 then it is ignored (i.e. potentially unlimited open trades, limited by the pairlist). [More information below](#configuring-amount-per-trade). [Strategy Override](#parameters-in-the-strategy).<br> **Datatype:** Positive integer or -1.
| `stake_currency` | **Required.** Crypto-currency used for trading. <br> **Datatype:** String
| `stake_amount` | **Required.** Amount of crypto-currency your bot will use for each trade. Set it to `"unlimited"` to allow the bot to use all available balance. [More information below](#configuring-amount-per-trade). <br> **Datatype:** Positive float or `"unlimited"`.
| `tradable_balance_ratio` | Ratio of the total account balance the bot is allowed to trade. [More information below](#configuring-amount-per-trade). <br>*Defaults to `0.99` 99%).*<br> **Datatype:** Positive float between `0.1` and `1.0`.
| `available_capital` | Available starting capital for the bot. Useful when running multiple bots on the same exchange account. [More information below](#configuring-amount-per-trade). <br> **Datatype:** Positive float.
| `amend_last_stake_amount` | Use reduced last stake amount if necessary. [More information below](#configuring-amount-per-trade). <br>*Defaults to `false`.* <br> **Datatype:** Boolean
| `last_stake_amount_min_ratio` | Defines minimum stake amount that has to be left and executed. Applies only to the last stake amount when it's amended to a reduced value (i.e. if `amend_last_stake_amount` is set to `true`). [More information below](#configuring-amount-per-trade). <br>*Defaults to `0.5`.* <br> **Datatype:** Float (as ratio)
| `amount_reserve_percent` | Reserve some amount in min pair stake amount. The bot will reserve `amount_reserve_percent` + stoploss value when calculating min pair stake amount in order to avoid possible trade refusals. <br>*Defaults to `0.05` (5%).* <br> **Datatype:** Positive Float as ratio.
| `timeframe` | The timeframe (former ticker interval) to use (e.g `1m`, `5m`, `15m`, `30m`, `1h` ...). [Strategy Override](#parameters-in-the-strategy). <br> **Datatype:** String
| `timeframe` | The timeframe to use (e.g `1m`, `5m`, `15m`, `30m`, `1h` ...). Usually missing in configuration, and specified in the strategy. [Strategy Override](#parameters-in-the-strategy). <br> **Datatype:** String
| `fiat_display_currency` | Fiat currency used to show your profits. [More information below](#what-values-can-be-used-for-fiat_display_currency). <br> **Datatype:** String
| `dry_run` | **Required.** Define if the bot must be in Dry Run or production mode. <br>*Defaults to `true`.* <br> **Datatype:** Boolean
| `dry_run_wallet` | Define the starting amount in stake currency for the simulated wallet used by the bot running in Dry Run mode.<br>*Defaults to `1000`.* <br> **Datatype:** Float
| `cancel_open_orders_on_exit` | Cancel open orders when the `/stop` RPC command is issued, `Ctrl+C` is pressed or the bot dies unexpectedly. When set to `true`, this allows you to use `/stop` to cancel unfilled and partially filled orders in the event of a market crash. It does not impact open positions. <br>*Defaults to `false`.* <br> **Datatype:** Boolean
| `process_only_new_candles` | Enable processing of indicators only when new candles arrive. If false each loop populates the indicators, this will mean the same candle is processed many times creating system load but can be useful of your strategy depends on tick data not only candle. [Strategy Override](#parameters-in-the-strategy). <br>*Defaults to `false`.* <br> **Datatype:** Boolean
| `minimal_roi` | **Required.** Set the threshold as ratio the bot will use to sell a trade. [More information below](#understand-minimal_roi). [Strategy Override](#parameters-in-the-strategy). <br> **Datatype:** Dict
| `process_only_new_candles` | Enable processing of indicators only when new candles arrive. If false each loop populates the indicators, this will mean the same candle is processed many times creating system load but can be useful of your strategy depends on tick data not only candle. [Strategy Override](#parameters-in-the-strategy). <br>*Defaults to `true`.* <br> **Datatype:** Boolean
| `minimal_roi` | **Required.** Set the threshold as ratio the bot will use to exit a trade. [More information below](#understand-minimal_roi). [Strategy Override](#parameters-in-the-strategy). <br> **Datatype:** Dict
| `stoploss` | **Required.** Value as ratio of the stoploss used by the bot. More details in the [stoploss documentation](stoploss.md). [Strategy Override](#parameters-in-the-strategy). <br> **Datatype:** Float (as ratio)
| `trailing_stop` | Enables trailing stoploss (based on `stoploss` in either configuration or strategy file). More details in the [stoploss documentation](stoploss.md#trailing-stop-loss). [Strategy Override](#parameters-in-the-strategy). <br> **Datatype:** Boolean
| `trailing_stop_positive` | Changes stoploss once profit has been reached. More details in the [stoploss documentation](stoploss.md#trailing-stop-loss-custom-positive-loss). [Strategy Override](#parameters-in-the-strategy). <br> **Datatype:** Float
| `trailing_stop_positive_offset` | Offset on when to apply `trailing_stop_positive`. Percentage value which should be positive. More details in the [stoploss documentation](stoploss.md#trailing-stop-loss-only-once-the-trade-has-reached-a-certain-offset). [Strategy Override](#parameters-in-the-strategy). <br>*Defaults to `0.0` (no offset).* <br> **Datatype:** Float
| `trailing_only_offset_is_reached` | Only apply trailing stoploss when the offset is reached. [stoploss documentation](stoploss.md). [Strategy Override](#parameters-in-the-strategy). <br>*Defaults to `false`.* <br> **Datatype:** Boolean
| `fee` | Fee used during backtesting / dry-runs. Should normally not be configured, which has freqtrade fall back to the exchange default fee. Set as ratio (e.g. 0.001 = 0.1%). Fee is applied twice for each trade, once when buying, once when selling. <br> **Datatype:** Float (as ratio)
| `unfilledtimeout.buy` | **Required.** How long (in minutes or seconds) the bot will wait for an unfilled buy order to complete, after which the order will be cancelled and repeated at current (new) price, as long as there is a signal. [Strategy Override](#parameters-in-the-strategy).<br> **Datatype:** Integer
| `unfilledtimeout.sell` | **Required.** How long (in minutes or seconds) the bot will wait for an unfilled sell order to complete, after which the order will be cancelled and repeated at current (new) price, as long as there is a signal. [Strategy Override](#parameters-in-the-strategy).<br> **Datatype:** Integer
| `unfilledtimeout.unit` | Unit to use in unfilledtimeout setting. Note: If you set unfilledtimeout.unit to "seconds", "internals.process_throttle_secs" must be inferior or equal to timeout [Strategy Override](#parameters-in-the-strategy). <br> *Defaults to `minutes`.* <br> **Datatype:** String
| `bid_strategy.price_side` | Select the side of the spread the bot should look at to get the buy rate. [More information below](#buy-price-side).<br>*Defaults to `bid`.* <br> **Datatype:** String (either `ask` or `bid`).
| `bid_strategy.ask_last_balance` | **Required.** Interpolate the bidding price. More information [below](#buy-price-without-orderbook-enabled).
| `bid_strategy.use_order_book` | Enable buying using the rates in [Order Book Bids](#buy-price-with-orderbook-enabled).<br> **Datatype:** Boolean
| `bid_strategy.order_book_top` | Bot will use the top N rate in Order Book Bids to buy. I.e. a value of 2 will allow the bot to pick the 2nd bid rate in [Order Book Bids](#buy-price-with-orderbook-enabled). <br>*Defaults to `1`.* <br> **Datatype:** Positive Integer
| `bid_strategy. check_depth_of_market.enabled` | Do not buy if the difference of buy orders and sell orders is met in Order Book. [Check market depth](#check-depth-of-market). <br>*Defaults to `false`.* <br> **Datatype:** Boolean
| `bid_strategy. check_depth_of_market.bids_to_ask_delta` | The difference ratio of buy orders and sell orders found in Order Book. A value below 1 means sell order size is greater, while value greater than 1 means buy order size is higher. [Check market depth](#check-depth-of-market) <br>*Defaults to `0`.* <br> **Datatype:** Float (as ratio)
| `ask_strategy.price_side` | Select the side of the spread the bot should look at to get the sell rate. [More information below](#sell-price-side).<br> *Defaults to `ask`.* <br> **Datatype:** String (either `ask` or `bid`).
| `ask_strategy.bid_last_balance` | Interpolate the selling price. More information [below](#sell-price-without-orderbook-enabled).
| `ask_strategy.use_order_book` | Enable selling of open trades using [Order Book Asks](#sell-price-with-orderbook-enabled). <br> **Datatype:** Boolean
| `ask_strategy.order_book_min` | Bot will scan from the top min to max Order Book Asks searching for a profitable rate. <br>*Defaults to `1`.*<br> **Datatype:** Positive Integer
| `ask_strategy.order_book_max` | Bot will scan from the top min to max Order Book Asks searching for a profitable rate. <br>*Defaults to `1`.* <br> **Datatype:** Positive Integer
| `ask_strategy.use_sell_signal` | Use sell signals produced by the strategy in addition to the `minimal_roi`. [Strategy Override](#parameters-in-the-strategy). <br>*Defaults to `true`.* <br> **Datatype:** Boolean
| `ask_strategy.sell_profit_only` | Wait until the bot reaches `ask_strategy.sell_profit_offset` before taking a sell decision. [Strategy Override](#parameters-in-the-strategy). <br>*Defaults to `false`.* <br> **Datatype:** Boolean
| `ask_strategy.sell_profit_offset` | Sell-signal is only active above this value. [Strategy Override](#parameters-in-the-strategy).<br>*Defaults to `0.0`.* <br> **Datatype:** Float (as ratio)
| `ask_strategy.ignore_roi_if_buy_signal` | Do not sell if the buy signal is still active. This setting takes preference over `minimal_roi` and `use_sell_signal`. [Strategy Override](#parameters-in-the-strategy). <br>*Defaults to `false`.* <br> **Datatype:** Boolean
| `ask_strategy.ignore_buying_expired_candle_after` | Specifies the number of seconds until a buy signal is no longer used. <br> **Datatype:** Integer
| `order_types` | Configure order-types depending on the action (`"buy"`, `"sell"`, `"stoploss"`, `"stoploss_on_exchange"`). [More information below](#understand-order_types). [Strategy Override](#parameters-in-the-strategy).<br> **Datatype:** Dict
| `order_time_in_force` | Configure time in force for buy and sell orders. [More information below](#understand-order_time_in_force). [Strategy Override](#parameters-in-the-strategy). <br> **Datatype:** Dict
| `futures_funding_rate` | User-specified funding rate to be used when historical funding rates are not available from the exchange. This does not overwrite real historical rates. It is recommended that this be set to 0 unless you are testing a specific coin and you understand how the funding rate will affect freqtrade's profit calculations. [More information here](leverage.md#unavailable-funding-rates) <br>*Defaults to `None`.*<br> **Datatype:** Float
| `trading_mode` | Specifies if you want to trade regularly, trade with leverage, or trade contracts whose prices are derived from matching cryptocurrency prices. [leverage documentation](leverage.md). <br>*Defaults to `"spot"`.* <br> **Datatype:** String
| `margin_mode` | When trading with leverage, this determines if the collateral owned by the trader will be shared or isolated to each trading pair [leverage documentation](leverage.md). <br> **Datatype:** String
| `liquidation_buffer` | A ratio specifying how large of a safety net to place between the liquidation price and the stoploss to prevent a position from reaching the liquidation price [leverage documentation](leverage.md).<br>*Defaults to `0.05`.* <br> **Datatype:** Float
| | **Unfilled timeout**
| `unfilledtimeout.entry` | **Required.** How long (in minutes or seconds) the bot will wait for an unfilled entry order to complete, after which the order will be cancelled and repeated at current (new) price, as long as there is a signal. [Strategy Override](#parameters-in-the-strategy).<br> **Datatype:** Integer
| `unfilledtimeout.exit` | **Required.** How long (in minutes or seconds) the bot will wait for an unfilled exit order to complete, after which the order will be cancelled and repeated at current (new) price, as long as there is a signal. [Strategy Override](#parameters-in-the-strategy).<br> **Datatype:** Integer
| `unfilledtimeout.unit` | Unit to use in unfilledtimeout setting. Note: If you set unfilledtimeout.unit to "seconds", "internals.process_throttle_secs" must be inferior or equal to timeout [Strategy Override](#parameters-in-the-strategy). <br>*Defaults to `"minutes"`.* <br> **Datatype:** String
| `unfilledtimeout.exit_timeout_count` | How many times can exit orders time out. Once this number of timeouts is reached, an emergency exit is triggered. 0 to disable and allow unlimited order cancels. [Strategy Override](#parameters-in-the-strategy).<br>*Defaults to `0`.* <br> **Datatype:** Integer
| | **Pricing**
| `entry_pricing.price_side` | Select the side of the spread the bot should look at to get the entry rate. [More information below](#entry-price).<br> *Defaults to `"same"`.* <br> **Datatype:** String (either `ask`, `bid`, `same` or `other`).
| `entry_pricing.price_last_balance` | **Required.** Interpolate the bidding price. More information [below](#entry-price-without-orderbook-enabled).
| `entry_pricing.use_order_book` | Enable entering using the rates in [Order Book Entry](#entry-price-with-orderbook-enabled). <br>*Defaults to `true`.*<br> **Datatype:** Boolean
| `entry_pricing.order_book_top` | Bot will use the top N rate in Order Book "price_side" to enter a trade. I.e. a value of 2 will allow the bot to pick the 2nd entry in [Order Book Entry](#entry-price-with-orderbook-enabled). <br>*Defaults to `1`.* <br> **Datatype:** Positive Integer
| `entry_pricing. check_depth_of_market.enabled` | Do not enter if the difference of buy orders and sell orders is met in Order Book. [Check market depth](#check-depth-of-market). <br>*Defaults to `false`.* <br> **Datatype:** Boolean
| `entry_pricing. check_depth_of_market.bids_to_ask_delta` | The difference ratio of buy orders and sell orders found in Order Book. A value below 1 means sell order size is greater, while value greater than 1 means buy order size is higher. [Check market depth](#check-depth-of-market) <br>*Defaults to `0`.* <br> **Datatype:** Float (as ratio)
| `exit_pricing.price_side` | Select the side of the spread the bot should look at to get the exit rate. [More information below](#exit-price-side).<br>*Defaults to `"same"`.* <br> **Datatype:** String (either `ask`, `bid`, `same` or `other`).
| `exit_pricing.price_last_balance` | Interpolate the exiting price. More information [below](#exit-price-without-orderbook-enabled).
| `exit_pricing.use_order_book` | Enable exiting of open trades using [Order Book Exit](#exit-price-with-orderbook-enabled). <br> *Defaults to `true`.*<br> **Datatype:** Boolean
| `exit_pricing.order_book_top` | Bot will use the top N rate in Order Book "price_side" to exit. I.e. a value of 2 will allow the bot to pick the 2nd ask rate in [Order Book Exit](#exit-price-with-orderbook-enabled)<br>*Defaults to `1`.* <br> **Datatype:** Positive Integer
| `custom_price_max_distance_ratio` | Configure maximum distance ratio between current and custom entry or exit price. <br>*Defaults to `0.02` 2%).*<br> **Datatype:** Positive float
| | **TODO**
| `use_exit_signal` | Use exit signals produced by the strategy in addition to the `minimal_roi`. [Strategy Override](#parameters-in-the-strategy). <br>*Defaults to `true`.* <br> **Datatype:** Boolean
| `exit_profit_only` | Wait until the bot reaches `exit_profit_offset` before taking an exit decision. [Strategy Override](#parameters-in-the-strategy). <br>*Defaults to `false`.* <br> **Datatype:** Boolean
| `exit_profit_offset` | Exit-signal is only active above this value. Only active in combination with `exit_profit_only=True`. [Strategy Override](#parameters-in-the-strategy). <br>*Defaults to `0.0`.* <br> **Datatype:** Float (as ratio)
| `ignore_roi_if_entry_signal` | Do not exit if the entry signal is still active. This setting takes preference over `minimal_roi` and `use_exit_signal`. [Strategy Override](#parameters-in-the-strategy). <br>*Defaults to `false`.* <br> **Datatype:** Boolean
| `ignore_buying_expired_candle_after` | Specifies the number of seconds until a buy signal is no longer used. <br> **Datatype:** Integer
| `order_types` | Configure order-types depending on the action (`"entry"`, `"exit"`, `"stoploss"`, `"stoploss_on_exchange"`). [More information below](#understand-order_types). [Strategy Override](#parameters-in-the-strategy).<br> **Datatype:** Dict
| `order_time_in_force` | Configure time in force for entry and exit orders. [More information below](#understand-order_time_in_force). [Strategy Override](#parameters-in-the-strategy). <br> **Datatype:** Dict
| `position_adjustment_enable` | Enables the strategy to use position adjustments (additional buys or sells). [More information here](strategy-callbacks.md#adjust-trade-position). <br> [Strategy Override](#parameters-in-the-strategy). <br>*Defaults to `false`.*<br> **Datatype:** Boolean
| `max_entry_position_adjustment` | Maximum additional order(s) for each open trade on top of the first entry Order. Set it to `-1` for unlimited additional orders. [More information here](strategy-callbacks.md#adjust-trade-position). <br> [Strategy Override](#parameters-in-the-strategy). <br>*Defaults to `-1`.*<br> **Datatype:** Positive Integer or -1
| | **Exchange**
| `exchange.name` | **Required.** Name of the exchange class to use. [List below](#user-content-what-values-for-exchangename). <br> **Datatype:** String
| `exchange.sandbox` | Use the 'sandbox' version of the exchange, where the exchange provides a sandbox for risk-free integration. See [here](sandbox-testing.md) in more details.<br> **Datatype:** Boolean
| `exchange.key` | API key to use for the exchange. Only required when you are in production mode.<br>**Keep it in secret, do not disclose publicly.** <br> **Datatype:** String
| `exchange.secret` | API secret to use for the exchange. Only required when you are in production mode.<br>**Keep it in secret, do not disclose publicly.** <br> **Datatype:** String
| `exchange.password` | API password to use for the exchange. Only required when you are in production mode and for exchanges that use password for API requests.<br>**Keep it in secret, do not disclose publicly.** <br> **Datatype:** String
| `exchange.uid` | API uid to use for the exchange. Only required when you are in production mode and for exchanges that use uid for API requests.<br>**Keep it in secret, do not disclose publicly.** <br> **Datatype:** String
| `exchange.pair_whitelist` | List of pairs to use by the bot for trading and to check for potential trades during backtesting. Supports regex pairs as `.*/BTC`. Not used by VolumePairList. [More information](plugins.md#pairlists-and-pairlist-handlers). <br> **Datatype:** List
| `exchange.pair_blacklist` | List of pairs the bot must absolutely avoid for trading and backtesting. [More information](plugins.md#pairlists-and-pairlist-handlers). <br> **Datatype:** List
| `exchange.ccxt_config` | Additional CCXT parameters passed to both ccxt instances (sync and async). This is usually the correct place for ccxt configurations. Parameters may differ from exchange to exchange and are documented in the [ccxt documentation](https://ccxt.readthedocs.io/en/latest/manual.html#instantiation) <br> **Datatype:** Dict
| `exchange.ccxt_config` | Additional CCXT parameters passed to both ccxt instances (sync and async). This is usually the correct place for additional ccxt configurations. Parameters may differ from exchange to exchange and are documented in the [ccxt documentation](https://ccxt.readthedocs.io/en/latest/manual.html#instantiation). Please avoid adding exchange secrets here (use the dedicated fields instead), as they may be contained in logs. <br> **Datatype:** Dict
| `exchange.ccxt_sync_config` | Additional CCXT parameters passed to the regular (sync) ccxt instance. Parameters may differ from exchange to exchange and are documented in the [ccxt documentation](https://ccxt.readthedocs.io/en/latest/manual.html#instantiation) <br> **Datatype:** Dict
| `exchange.ccxt_async_config` | Additional CCXT parameters passed to the async ccxt instance. Parameters may differ from exchange to exchange and are documented in the [ccxt documentation](https://ccxt.readthedocs.io/en/latest/manual.html#instantiation) <br> **Datatype:** Dict
| `exchange.markets_refresh_interval` | The interval in minutes in which markets are reloaded. <br>*Defaults to `60` minutes.* <br> **Datatype:** Positive Integer
| `exchange.skip_pair_validation` | Skip pairlist validation on startup.<br>*Defaults to `false`<br> **Datatype:** Boolean
| `exchange.skip_open_order_update` | Skips open order updates on startup should the exchange cause problems. Only relevant in live conditions.<br>*Defaults to `false`<br> **Datatype:** Boolean
| `exchange.log_responses` | Log relevant exchange responses. For debug mode only - use with care.<br>*Defaults to `false`<br> **Datatype:** Boolean
| `edge.*` | Please refer to [edge configuration document](edge.md) for detailed explanation.
| `exchange.skip_pair_validation` | Skip pairlist validation on startup.<br>*Defaults to `false`*<br> **Datatype:** Boolean
| `exchange.skip_open_order_update` | Skips open order updates on startup should the exchange cause problems. Only relevant in live conditions.<br>*Defaults to `false`*<br> **Datatype:** Boolean
| `exchange.unknown_fee_rate` | Fallback value to use when calculating trading fees. This can be useful for exchanges which have fees in non-tradable currencies. The value provided here will be multiplied with the "fee cost".<br>*Defaults to `None`<br> **Datatype:** float
| `exchange.log_responses` | Log relevant exchange responses. For debug mode only - use with care.<br>*Defaults to `false`*<br> **Datatype:** Boolean
| `experimental.block_bad_exchanges` | Block exchanges known to not work with freqtrade. Leave on default unless you want to test if that exchange works now. <br>*Defaults to `true`.* <br> **Datatype:** Boolean
| | **Plugins**
| `edge.*` | Please refer to [edge configuration document](edge.md) for detailed explanation of all possible configuration options.
| `pairlists` | Define one or more pairlists to be used. [More information](plugins.md#pairlists-and-pairlist-handlers). <br>*Defaults to `StaticPairList`.* <br> **Datatype:** List of Dicts
| `protections` | Define one or more protections to be used. [More information](plugins.md#protections). <br> **Datatype:** List of Dicts
| | **Telegram**
| `telegram.enabled` | Enable the usage of Telegram. <br> **Datatype:** Boolean
| `telegram.token` | Your Telegram bot token. Only required if `telegram.enabled` is `true`. <br>**Keep it in secret, do not disclose publicly.** <br> **Datatype:** String
| `telegram.chat_id` | Your personal Telegram account id. Only required if `telegram.enabled` is `true`. <br>**Keep it in secret, do not disclose publicly.** <br> **Datatype:** String
| `telegram.balance_dust_level` | Dust-level (in stake currency) - currencies with a balance below this will not be shown by `/balance`. <br> **Datatype:** float
| `telegram.reload` | Allow "reload" buttons on telegram messages. <br>*Defaults to `true`.<br> **Datatype:** boolean
| `telegram.notification_settings.*` | Detailed notification settings. Refer to the [telegram documentation](telegram-usage.md) for details.<br> **Datatype:** dictionary
| `telegram.allow_custom_messages` | Enable the sending of Telegram messages from strategies via the dataprovider.send_msg() function. <br> **Datatype:** Boolean
| `webhook.url` | URL for the webhook. Only required if `webhook.enabled` is `true`. See the [webhook documentation](webhook-config.md) for more details. <br> **Datatype:** String
| `webhook.webhookbuy` | Payload to send on buy. Only required if `webhook.enabled` is `true`. See the [webhook documentation](webhook-config.md) for more details. <br> **Datatype:** String
| `webhook.webhookbuycancel` | Payload to send on buy order cancel. Only required if `webhook.enabled` is `true`. See the [webhook documentation](webhook-config.md) for more details. <br> **Datatype:** String
| `webhook.webhooksell` | Payload to send on sell. Only required if `webhook.enabled` is `true`. See the [webhook documentation](webhook-config.md) for more details. <br> **Datatype:** String
| `webhook.webhooksellcancel` | Payload to send on sell order cancel. Only required if `webhook.enabled` is `true`. See the [webhook documentation](webhook-config.md) for more details. <br> **Datatype:** String
| `webhook.webhookstatus` | Payload to send on status calls. Only required if `webhook.enabled` is `true`. See the [webhook documentation](webhook-config.md) for more details. <br> **Datatype:** String
| `webhook.entry` | Payload to send on entry. Only required if `webhook.enabled` is `true`. See the [webhook documentation](webhook-config.md) for more details. <br> **Datatype:** String
| `webhook.entry_cancel` | Payload to send on entry order cancel. Only required if `webhook.enabled` is `true`. See the [webhook documentation](webhook-config.md) for more details. <br> **Datatype:** String
| `webhook.entry_fill` | Payload to send on entry order filled. Only required if `webhook.enabled` is `true`. See the [webhook documentation](webhook-config.md) for more details. <br> **Datatype:** String
| `webhook.exit` | Payload to send on exit. Only required if `webhook.enabled` is `true`. See the [webhook documentation](webhook-config.md) for more details. <br> **Datatype:** String
| `webhook.exit_cancel` | Payload to send on exit order cancel. Only required if `webhook.enabled` is `true`. See the [webhook documentation](webhook-config.md) for more details. <br> **Datatype:** String
| `webhook.exit_fill` | Payload to send on exit order filled. Only required if `webhook.enabled` is `true`. See the [webhook documentation](webhook-config.md) for more details. <br> **Datatype:** String
| `webhook.status` | Payload to send on status calls. Only required if `webhook.enabled` is `true`. See the [webhook documentation](webhook-config.md) for more details. <br> **Datatype:** String
| `webhook.allow_custom_messages` | Enable the sending of Webhook messages from strategies via the dataprovider.send_msg() function. <br> **Datatype:** Boolean
| | **Rest API / FreqUI / Producer-Consumer**
| `api_server.enabled` | Enable usage of API Server. See the [API Server documentation](rest-api.md) for more details. <br> **Datatype:** Boolean
| `api_server.listen_ip_address` | Bind IP address. See the [API Server documentation](rest-api.md) for more details. <br> **Datatype:** IPv4
| `api_server.listen_port` | Bind Port. See the [API Server documentation](rest-api.md) for more details. <br>**Datatype:** Integer between 1024 and 65535
| `api_server.verbosity` | Logging verbosity. `info` will print all RPC Calls, while "error" will only display errors. <br>**Datatype:** Enum, either `info` or `error`. Defaults to `info`.
| `api_server.username` | Username for API server. See the [API Server documentation](rest-api.md) for more details. <br>**Keep it in secret, do not disclose publicly.**<br> **Datatype:** String
| `api_server.password` | Password for API server. See the [API Server documentation](rest-api.md) for more details. <br>**Keep it in secret, do not disclose publicly.**<br> **Datatype:** String
| `api_server.ws_token` | API token for the Message WebSocket. See the [API Server documentation](rest-api.md) for more details. <br>**Keep it in secret, do not disclose publicly.** <br> **Datatype:** String
| `bot_name` | Name of the bot. Passed via API to a client - can be shown to distinguish / name bots.<br> *Defaults to `freqtrade`*<br> **Datatype:** String
| `db_url` | Declares database URL to use. NOTE: This defaults to `sqlite:///tradesv3.dryrun.sqlite` if `dry_run` is `true`, and to `sqlite:///tradesv3.sqlite` for production instances. <br> **Datatype:** String, SQLAlchemy connect string
| `external_message_consumer` | Enable [Producer/Consumer mode](producer-consumer.md) for more details. <br> **Datatype:** Dict
| | **Other**
| `initial_state` | Defines the initial application state. If set to stopped, then the bot has to be explicitly started via `/start` RPC command. <br>*Defaults to `stopped`.* <br> **Datatype:** Enum, either `stopped` or `running`
| `forcebuy_enable` | Enables the RPC Commands to force a buy. More information below. <br> **Datatype:** Boolean
| `force_entry_enable` | Enables the RPC Commands to force a Trade entry. More information below. <br> **Datatype:** Boolean
| `disable_dataframe_checks` | Disable checking the OHLCV dataframe returned from the strategy methods for correctness. Only use when intentionally changing the dataframe and understand what you are doing. [Strategy Override](#parameters-in-the-strategy).<br> *Defaults to `False`*. <br> **Datatype:** Boolean
| `strategy` | **Required** Defines Strategy class to use. Recommended to be set via `--strategy NAME`. <br> **Datatype:** ClassName
| `strategy_path` | Adds an additional strategy lookup path (must be a directory). <br> **Datatype:** String
| `internals.process_throttle_secs` | Set the process throttle, or minimum loop duration for one bot iteration loop. Value in second. <br>*Defaults to `5` seconds.* <br> **Datatype:** Positive Integer
| `internals.heartbeat_interval` | Print heartbeat message every N seconds. Set to 0 to disable heartbeat messages. <br>*Defaults to `60` seconds.* <br> **Datatype:** Positive Integer or 0
| `internals.sd_notify` | Enables use of the sd_notify protocol to tell systemd service manager about changes in the bot state and issue keep-alive pings. See [here](installation.md#7-optional-configure-freqtrade-as-a-systemd-service) for more details. <br> **Datatype:** Boolean
| `logfile` | Specifies logfile name. Uses a rolling strategy for log file rotation for 10 files with the 1MB limit per file. <br> **Datatype:** String
| `strategy` | **Required** Defines Strategy class to use. Recommended to be set via `--strategy NAME`. <br> **Datatype:** ClassName
| `strategy_path` | Adds an additional strategy lookup path (must be a directory). <br> **Datatype:** String
| `recursive_strategy_search` | Set to `true` to recursively search sub-directories inside `user_data/strategies` for a strategy. <br> **Datatype:** Boolean
| `user_data_dir` | Directory containing user data. <br> *Defaults to `./user_data/`*. <br> **Datatype:** String
| `dataformat_ohlcv` | Data format to use to store historical candle (OHLCV) data. <br> *Defaults to `json`*. <br> **Datatype:** String
| `dataformat_trades` | Data format to use to store historical trades data. <br> *Defaults to `jsongz`*. <br> **Datatype:** String
| `db_url` | Declares database URL to use. NOTE: This defaults to `sqlite:///tradesv3.dryrun.sqlite` if `dry_run` is `true`, and to `sqlite:///tradesv3.sqlite` for production instances. <br> **Datatype:** String, SQLAlchemy connect string
| `logfile` | Specifies logfile name. Uses a rolling strategy for log file rotation for 10 files with the 1MB limit per file. <br> **Datatype:** String
| `add_config_files` | Additional config files. These files will be loaded and merged with the current config file. The files are resolved relative to the initial file.<br> *Defaults to `[]`*. <br> **Datatype:** List of strings
| `dataformat_ohlcv` | Data format to use to store historical candle (OHLCV) data. <br> *Defaults to `feather`*. <br> **Datatype:** String
| `dataformat_trades` | Data format to use to store historical trades data. <br> *Defaults to `feather`*. <br> **Datatype:** String
| `reduce_df_footprint` | Recast all numeric columns to float32/int32, with the objective of reducing ram/disk usage (and decreasing train/inference timing in FreqAI). (Currently only affects FreqAI use-cases) <br> **Datatype:** Boolean. <br> Default: `False`.
### Parameters in the strategy
The following parameters can be set in configuration file or strategy.
The following parameters can be set in the configuration file or strategy.
Values set in the configuration file always overwrite values set in the strategy.
* `minimal_roi`
* `timeframe`
* `stoploss`
* `max_open_trades`
* `trailing_stop`
* `trailing_stop_positive`
* `trailing_stop_positive_offset`
@@ -157,51 +273,68 @@ Values set in the configuration file always overwrite values set in the strategy
There are several methods to configure how much of the stake currency the bot will use to enter a trade. All methods respect the [available balance configuration](#available-balance) as explained below.
There are several methods to configure how much of the stake currency the bot will use to enter a trade. All methods respect the [available balance configuration](#tradable-balance) as explained below.
#### Minimum trade stake
The minimum stake amount will depend by exchange and pair, and is usually listed in the exchange support pages.
Assuming the minimum tradable amount for XRP/USD is 20 XRP (given by the exchange), and the price is 0.6$.
The minimum stake amount will depend on exchange and pair and is usually listed in the exchange support pages.
The minimum stake amount to buy this pair is therefore `20 * 0.6 ~= 12`.
Assuming the minimum tradable amount for XRP/USD is 20 XRP (given by the exchange), and the price is 0.6$, the minimum stake amount to buy this pair is `20 * 0.6 ~= 12`.
This exchange has also a limit on USD - where all orders must be > 10$ - which however does not apply in this case.
To guarantee safe execution, freqtrade will not allow buying with a stake-amount of 10.1$, instead, it'll make sure that there's enough space to place a stoploss below the pair (+ an offset, defined by `amount_reserve_percent`, which defaults to 5%).
With a reserve of 5%, the minimum stake amount would be ~12.6$ (`12 * (1 + 0.05)`). If we take in account a stoploss of 10% on top of that - we'd end up with a value of ~14$ (`12.6 / (1 - 0.1)`).
With a reserve of 5%, the minimum stake amount would be ~12.6$ (`12 * (1 + 0.05)`). If we take into account a stoploss of 10% on top of that - we'd end up with a value of ~14$ (`12.6 / (1 - 0.1)`).
To limit this calculation in case of large stoploss values, the calculated minimum stake-limit will never be more than 50% above the real limit.
!!! Warning
Since the limits on exchanges are usually stable and are not updated often, some pairs can show pretty high minimum limits, simply because the price increased a lot since the last limit adjustment by the exchange.
Since the limits on exchanges are usually stable and are not updated often, some pairs can show pretty high minimum limits, simply because the price increased a lot since the last limit adjustment by the exchange. Freqtrade adjusts the stake-amount to this value, unless it's > 30% more than the calculated/desired stake-amount - in which case the trade is rejected.
#### Available balance
#### Tradable balance
By default, the bot assumes that the `complete amount - 1%` is at it's disposal, and when using [dynamic stake amount](#dynamic-stake-amount), it will split the complete balance into `max_open_trades` buckets per trade.
Freqtrade will reserve 1% for eventual fees when entering a trade and will therefore not touch that by default.
You can configure the "untouched" amount by using the `tradable_balance_ratio` setting.
For example, if you have 10 ETH available in your wallet on the exchange and `tradable_balance_ratio=0.5` (which is 50%), then the bot will use a maximum amount of 5 ETH for trading and considers this as available balance. The rest of the wallet is untouched by the trades.
For example, if you have 10 ETH available in your wallet on the exchange and `tradable_balance_ratio=0.5` (which is 50%), then the bot will use a maximum amount of 5 ETH for trading and considers this as an available balance. The rest of the wallet is untouched by the trades.
!!! Danger
This setting should **not** be used when running multiple bots on the same account. Please look at [Available Capital to the bot](#assign-available-capital) instead.
!!! Warning
The `tradable_balance_ratio` setting applies to the current balance (free balance + tied up in trades). Therefore, assuming the starting balance of 1000, a configuration with `tradable_balance_ratio=0.99` will not guarantee that 10 currency units will always remain available on the exchange. For example, the free amount may reduce to 5 units if the total balance is reduced to 500 (either by a losing streak, or by withdrawing balance).
The `tradable_balance_ratio` setting applies to the current balance (free balance + tied up in trades). Therefore, assuming the starting balance of 1000, a configuration with `tradable_balance_ratio=0.99` will not guarantee that 10 currency units will always remain available on the exchange. For example, the free amount may reduce to 5 units if the total balance is reduced to 500 (either by a losing streak or by withdrawing balance).
#### Assign available Capital
To fully utilize compounding profits when using multiple bots on the same exchange account, you'll want to limit each bot to a certain starting balance.
This can be accomplished by setting `available_capital` to the desired starting balance.
Assuming your account has 10.000 USDT and you want to run 2 different strategies on this exchange.
You'd set `available_capital=5000` - granting each bot an initial capital of 5000 USDT.
The bot will then split this starting balance equally into `max_open_trades` buckets.
Profitable trades will result in increased stake-sizes for this bot - without affecting the stake-sizes of the other bot.
!!! Warning "Incompatible with `tradable_balance_ratio`"
Setting this option will replace any configuration of `tradable_balance_ratio`.
#### Amend last stake amount
Assuming we have the tradable balance of 1000 USDT, `stake_amount=400`, and `max_open_trades=3`.
The bot would open 2 trades, and will be unable to fill the last trading slot, since the requested 400 USDT are no longer available, since 800 USDT are already tied in other trades.
The bot would open 2 trades and will be unable to fill the last trading slot, since the requested 400 USDT are no longer available since 800 USDT are already tied in other trades.
To overcome this, the option `amend_last_stake_amount` can be set to `True`, which will enable the bot to reduce stake_amount to the available balance in order to fill the last trade slot.
To overcome this, the option `amend_last_stake_amount` can be set to `True`, which will enable the bot to reduce stake_amount to the available balance to fill the last trade slot.
In the example above this would mean:
@@ -229,7 +362,7 @@ For example, the bot will at most use (0.05 BTC x 3) = 0.15 BTC, assuming a conf
#### Dynamic stake amount
Alternatively, you can use a dynamic stake amount, which will use the available balance on the exchange, and divide that equally by the amount of allowed trades (`max_open_trades`).
Alternatively, you can use a dynamic stake amount, which will use the available balance on the exchange, and divide that equally by the number of allowed trades (`max_open_trades`).
To configure this, set `stake_amount="unlimited"`. We also recommend to set `tradable_balance_ratio=0.99` (99%) - to keep a minimum balance for eventual fees.
@@ -247,42 +380,51 @@ To allow the bot to trade all the available `stake_currency` in your account (mi
```
!!! Tip "Compounding profits"
This configuration will allow increasing / decreasing stakes depending on the performance of the bot (lower stake if bot is loosing, higher stakes if the bot has a winning record, since higher balances are available), and will result in profit compounding.
This configuration will allow increasing/decreasing stakes depending on the performance of the bot (lower stake if the bot is losing, higher stakes if the bot has a winning record since higher balances are available), and will result in profit compounding.
!!! Note "When using Dry-Run Mode"
When using `"stake_amount" : "unlimited",` in combination with Dry-Run, Backtesting or Hyperopt, the balance will be simulated starting with a stake of `dry_run_wallet` which will evolve over time.
It is therefore important to set `dry_run_wallet` to a sensible value (like 0.05 or 0.01 for BTC and 1000 or 100 for USDT, for example), otherwise it may simulate trades with 100 BTC (or more) or 0.05 USDT (or less) at once - which may not correspond to your real available balance or is less than the exchange minimal limit for the order amount for the stake currency.
When using `"stake_amount" : "unlimited",` in combination with Dry-Run, Backtesting or Hyperopt, the balance will be simulated starting with a stake of `dry_run_wallet` which will evolve.
It is therefore important to set `dry_run_wallet` to a sensible value (like 0.05 or 0.01 for BTC and 1000 or 100 for USDT, for example), otherwise, it may simulate trades with 100 BTC (or more) or 0.05 USDT (or less) at once - which may not correspond to your real available balance or is less than the exchange minimal limit for the order amount for the stake currency.
#### Dynamic stake amount with position adjustment
When you want to use position adjustment with unlimited stakes, you must also implement `custom_stake_amount` to a return a value depending on your strategy.
Typical value would be in the range of 25% - 50% of the proposed stakes, but depends highly on your strategy and how much you wish to leave into the wallet as position adjustment buffer.
For example if your position adjustment assumes it can do 2 additional buys with the same stake amounts then your buffer should be 66.6667% of the initially proposed unlimited stake amount.
Or another example if your position adjustment assumes it can do 1 additional buy with 3x the original stake amount then `custom_stake_amount` should return 25% of proposed stake amount and leave 75% for possible later position adjustments.
--8<-- "includes/pricing.md"
### Understand minimal_roi
The `minimal_roi` configuration parameter is a JSON object where the key is a duration
in minutes and the value is the minimum ROI as ratio.
in minutes and the value is the minimum ROI as a ratio.
See the example below:
```json
"minimal_roi": {
"40": 0.0, # Sell after 40 minutes if the profit is not negative
"30": 0.01, # Sell after 30 minutes if there is at least 1% profit
"20": 0.02, # Sell after 20 minutes if there is at least 2% profit
"0": 0.04 # Sell immediately if there is at least 4% profit
"40": 0.0, # Exit after 40 minutes if the profit is not negative
"30": 0.01, # Exit after 30 minutes if there is at least 1% profit
"20": 0.02, # Exit after 20 minutes if there is at least 2% profit
"0": 0.04 # Exit immediately if there is at least 4% profit
},
```
Most of the strategy files already include the optimal `minimal_roi` value.
This parameter can be set in either Strategy or Configuration file. If you use it in the configuration file, it will override the
`minimal_roi` value from the strategy file.
If it is not set in either Strategy or Configuration, a default of 1000% `{"0": 10}` is used, and minimal roi is disabled unless your trade generates 1000% profit.
If it is not set in either Strategy or Configuration, a default of 1000% `{"0": 10}` is used, and minimal ROI is disabled unless your trade generates 1000% profit.
!!! Note "Special case to forcesell after a specific time"
A special case presents using `"<N>": -1` as ROI. This forces the bot to sell a trade after N Minutes, no matter if it's positive or negative, so represents a time-limited force-sell.
!!! Note "Special case to forceexit after a specific time"
A special case presents using `"<N>": -1` as ROI. This forces the bot to exit a trade after N Minutes, no matter if it's positive or negative, so represents a time-limited force-exit.
### Understand forcebuy_enable
### Understand force_entry_enable
The `forcebuy_enable` configuration parameter enables the usage of forcebuy commands via Telegram and REST API.
The `force_entry_enable` configuration parameter enables the usage of force-enter (`/forcelong`, `/forceshort`) commands via Telegram and REST API.
For security reasons, it's disabled by default, and freqtrade will show a warning message on startup if enabled.
For example, you can send `/forcebuy ETH/BTC` to the bot, which will result in freqtrade buying the pair and holds it until a regular sell-signal (ROI, stoploss, /forcesell) appears.
For example, you can send `/forceenter ETH/BTC` to the bot, which will result in freqtrade buying the pair and holds it until a regular exit-signal (ROI, stoploss, /forceexit) appears.
This can be dangerous with some strategies, so use with care.
@@ -292,16 +434,16 @@ See [the telegram documentation](telegram-usage.md) for details on usage.
When working with larger timeframes (for example 1h or more) and using a low `max_open_trades` value, the last candle can be processed as soon as a trade slot becomes available. When processing the last candle, this can lead to a situation where it may not be desirable to use the buy signal on that candle. For example, when using a condition in your strategy where you use a cross-over, that point may have passed too long ago for you to start a trade on it.
In these situations, you can enable the functionality to ignore candles that are beyond a specified period by setting `ask_strategy.ignore_buying_expired_candle_after` to a positive number, indicating the number of seconds after which the buy signal becomes expired.
In these situations, you can enable the functionality to ignore candles that are beyond a specified period by setting `ignore_buying_expired_candle_after` to a positive number, indicating the number of seconds after which the buy signal becomes expired.
For example, if your strategy is using a 1h timeframe, and you only want to buy within the first 5 minutes when a new candle comes in, you can add the following configuration to your strategy:
``` json
"ask_strategy":{
{
//...
"ignore_buying_expired_candle_after": 300,
"price_side": "bid",
// ...
},
}
```
!!! Note
@@ -309,29 +451,27 @@ For example, if your strategy is using a 1h timeframe, and you only want to buy
### Understand order_types
The `order_types` configuration parameter maps actions (`buy`, `sell`, `stoploss`, `emergencysell`, `forcesell`, `forcebuy`) to order-types (`market`, `limit`, ...) as well as configures stoploss to be on the exchange and defines stoploss on exchange update interval in seconds.
The `order_types` configuration parameter maps actions (`entry`, `exit`, `stoploss`, `emergency_exit`, `force_exit`, `force_entry`) to order-types (`market`, `limit`, ...) as well as configures stoploss to be on the exchange and defines stoploss on exchange update interval in seconds.
This allows to enter using limit orders, exit using limit-orders, and create stoplosses using market orders.
It also allows to set the
stoploss "on exchange" which means stoploss order would be placed immediately once the buy order is fulfilled.
This allows to buy using limit orders, sell using
limit-orders, and create stoplosses using market orders. It also allows to set the
stoploss "on exchange" which means stoploss order would be placed immediately once
the buy order is fulfilled.
`order_types` set in the configuration file overwrites values set in the strategy as a whole, so you need to configure the whole `order_types` dictionary in one place.
If this is configured, the following 4 values (`buy`, `sell`, `stoploss` and
`stoploss_on_exchange`) need to be present, otherwise the bot will fail to start.
If this is configured, the following 4 values (`entry`, `exit`, `stoploss` and `stoploss_on_exchange`) need to be present, otherwise, the bot will fail to start.
For information on (`emergencysell`,`forcesell`, `forcebuy`, `stoploss_on_exchange`,`stoploss_on_exchange_interval`,`stoploss_on_exchange_limit_ratio`) please see stop loss documentation [stop loss on exchange](stoploss.md)
For information on (`emergency_exit`,`force_exit`, `force_entry`, `stoploss_on_exchange`,`stoploss_on_exchange_interval`,`stoploss_on_exchange_limit_ratio`) please see stop loss documentation [stop loss on exchange](stoploss.md)
Syntax for Strategy:
```python
order_types = {
"buy": "limit",
"sell": "limit",
"emergencysell": "market",
"forcebuy": "market",
"forcesell": "market",
"entry": "limit",
"exit": "limit",
"emergency_exit": "market",
"force_entry": "market",
"force_exit": "market",
"stoploss": "market",
"stoploss_on_exchange": False,
"stoploss_on_exchange_interval": 60,
@@ -343,11 +483,11 @@ Configuration:
```json
"order_types": {
"buy": "limit",
"sell": "limit",
"emergencysell": "market",
"forcebuy": "market",
"forcesell": "market",
"entry": "limit",
"exit": "limit",
"emergency_exit": "market",
"force_entry": "market",
"force_exit": "market",
"stoploss": "market",
"stoploss_on_exchange": false,
"stoploss_on_exchange_interval": 60
@@ -370,7 +510,7 @@ Configuration:
If `stoploss_on_exchange` is enabled and the stoploss is cancelled manually on the exchange, then the bot will create a new stoploss order.
If stoploss on exchange creation fails for some reason, then an "emergency sell" is initiated. By default, this will sell the asset using a market order. The order-type for the emergency-sell can be changed by setting the `emergencysell` value in the `order_types` dictionary - however this is not advised.
If stoploss on exchange creation fails for some reason, then an "emergency exit" is initiated. By default, this will exit the trade using a market order. The order-type for the emergency-exit can be changed by setting the `emergency_exit` value in the `order_types` dictionary - however, this is not advised.
### Understand order_time_in_force
@@ -380,73 +520,41 @@ is executed on the exchange. Three commonly used time in force are:
**GTC (Good Till Canceled):**
This is most of the time the default time in force. It means the order will remain
on exchange till it is canceled by user. It can be fully or partially fulfilled.
on exchange till it is cancelled by the user. It can be fully or partially fulfilled.
If partially fulfilled, the remaining will stay on the exchange till cancelled.
**FOK (Fill Or Kill):**
It means if the order is not executed immediately AND fully then it is canceled by the exchange.
It means if the order is not executed immediately AND fully then it is cancelled by the exchange.
**IOC (Immediate Or Canceled):**
It is the same as FOK (above) except it can be partially fulfilled. The remaining part
is automatically cancelled by the exchange.
The `order_time_in_force` parameter contains a dict with buy and sell time in force policy values.
**PO (Post only):**
Post only order. The order is either placed as a maker order, or it is canceled.
This means the order must be placed on orderbook for at at least time in an unfilled state.
#### time_in_force config
The `order_time_in_force` parameter contains a dict with entry and exit time in force policy values.
This can be set in the configuration file or in the strategy.
Values set in the configuration file overwrites values set in the strategy.
The possible values are: `gtc` (default), `fok` or `ioc`.
The possible values are: `GTC` (default), `FOK` or `IOC`.
``` python
"order_time_in_force": {
"buy": "gtc",
"sell": "gtc"
"entry": "GTC",
"exit": "GTC"
},
```
!!! Warning
This is an ongoing work. For now it is supported only for binance.
Please don't change the default value unless you know what you are doing and have researched the impact of using different values.
### Exchange configuration
Freqtrade is based on [CCXT library](https://github.com/ccxt/ccxt) that supports over 100 cryptocurrency
exchange markets and trading APIs. The complete up-to-date list can be found in the
However, the bot was tested by the development team with only Bittrex, Binance and Kraken,
so the these are the only officially supported exchanges:
- [Bittrex](https://bittrex.com/): "bittrex"
- [Binance](https://www.binance.com/): "binance"
- [Kraken](https://kraken.com/): "kraken"
Feel free to test other exchanges and submit your PR to improve the bot.
Some exchanges require special configuration, which can be found on the [Exchange-specific Notes](exchanges.md) documentation page.
#### Sample exchange configuration
A exchange configuration for "binance" would look as follows:
```json
"exchange": {
"name": "binance",
"key": "your_exchange_key",
"secret": "your_exchange_secret",
"ccxt_config": {"enableRateLimit": true},
"ccxt_async_config": {
"enableRateLimit": true,
"rateLimit": 200
},
```
This configuration enables binance, as well as rate limiting to avoid bans from the exchange.
`"rateLimit": 200` defines a wait-event of 0.2s between each call. This can also be completely disabled by setting `"enableRateLimit"` to false.
!!! Note
Optimal settings for rate limiting depend on the exchange and the size of the whitelist, so an ideal parameter will vary on many other settings.
We try to provide sensible defaults per exchange where possible, if you encounter bans please make sure that `"enableRateLimit"` is enabled and increase the `"rateLimit"` parameter step by step.
This is ongoing work. For now, it is supported only for binance, gate and kucoin.
Please don't change the default value unless you know what you are doing and have researched the impact of using different values for your particular exchange.
### What values can be used for fiat_display_currency?
In addition to fiat currencies, a range of cryto currencies are supported.
In addition to fiat currencies, a range of crypto currencies is supported.
The valid values are:
@@ -470,7 +578,7 @@ The valid values are:
## Using Dry-run mode
We recommend starting the bot in the Dry-run mode to see how your bot will
behave and what is the performance of your strategy. In the Dry-run mode the
behave and what is the performance of your strategy. In the Dry-run mode, the
bot does not engage your money. It only runs a live simulation without
creating trades on the exchange.
@@ -486,17 +594,17 @@ creating trades on the exchange.
```json
"exchange": {
"name": "bittrex",
"key": "key",
"secret": "secret",
...
"name": "bittrex",
"key": "key",
"secret": "secret",
...
}
```
Once you will be happy with your bot performance running in the Dry-run mode, you can switch it to production mode.
!!! Note
A simulated wallet is available during dry-run mode, and will assume a starting capital of `dry_run_wallet` (defaults to 1000).
A simulated wallet is available during dry-run mode and will assume a starting capital of `dry_run_wallet` (defaults to 1000).
### Considerations for dry-run
@@ -504,20 +612,21 @@ Once you will be happy with your bot performance running in the Dry-run mode, yo
* Wallets (`/balance`) are simulated based on `dry_run_wallet`.
* Orders are simulated, and will not be posted to the exchange.
* Market orders fill based on orderbook volume the moment the order is placed.
* Limit orders fill once price reaches the defined level - or time out based on `unfilledtimeout` settings.
* Limit orders fill once the price reaches the defined level - or time out based on `unfilledtimeout` settings.
* In combination with `stoploss_on_exchange`, the stop_loss price is assumed to be filled.
* Open orders (not trades, which are stored in the database) are reset on bot restart.
* Open orders (not trades, which are stored in the database) are kept open after bot restarts, with the assumption that they were not filled while being offline.
## Switch to production mode
In production mode, the bot will engage your money. Be careful, since a wrong
strategy can lose all your money. Be aware of what you are doing when
you run it in production mode.
In production mode, the bot will engage your money. Be careful, since a wrong strategy can lose all your money.
Be aware of what you are doing when you run it in production mode.
When switching to Production mode, please make sure to use a different / fresh database to avoid dry-run trades messing with your exchange money and eventually tainting your statistics.
### Setup your exchange account
You will need to create API Keys (usually you get `key` and `secret`, some exchanges require an additional `password`) from the Exchange website and you'll need to insert this into the appropriate fields in the configuration or when asked by the `freqtrade new-config` command.
API Keys are usually only required for live trading (trading for real money, bot running in "production mode", executing real orders on the exchange) and are not required for the bot running in dry-run (trade simulation) mode. When you setup the bot in dry-run mode, you may fill these fields with empty values.
API Keys are usually only required for live trading (trading for real money, bot running in "production mode", executing real orders on the exchange) and are not required for the bot running in dry-run (trade simulation) mode. When you setup the bot in dry-run mode, you may fill these fields with empty values.
### To switch your bot in production mode
@@ -529,7 +638,7 @@ API Keys are usually only required for live trading (trading for real money, bot
"dry_run": false,
```
**Insert your Exchange API key (change them by fake api keys):**
**Insert your Exchange API key (change them by fake API keys):**
```json
{
@@ -547,7 +656,7 @@ API Keys are usually only required for live trading (trading for real money, bot
You should also make sure to read the [Exchanges](exchanges.md) section of the documentation to be aware of potential configuration details specific to your exchange.
!!! Hint "Keep your secrets secret"
To keep your secrets secret, we recommend to use a 2nd configuration for your API keys.
To keep your secrets secret, we recommend using a 2nd configuration for your API keys.
Simply use the above snippet in a new configuration file (e.g. `config-private.json`) and keep your settings in this file.
You can then start the bot with `freqtrade trade --config user_data/config.json --config user_data/config-private.json <...>` to have your keys loaded.
@@ -555,17 +664,8 @@ You should also make sure to read the [Exchanges](exchanges.md) section of the d
### Using proxy with Freqtrade
To use a proxy with freqtrade, add the kwarg `"aiohttp_trust_env"=true` to the `"ccxt_async_kwargs"` dict in the exchange section of the configuration.
An example for this can be found in `config_full.json.example`
``` json
"ccxt_async_config": {
"aiohttp_trust_env": true
}
```
Then, export your proxy settings using the variables `"HTTP_PROXY"` and `"HTTPS_PROXY"` set to the appropriate values
To use a proxy with freqtrade, export your proxy settings using the variables `"HTTP_PROXY"` and `"HTTPS_PROXY"` set to the appropriate values.
This will have the proxy settings applied to everything (telegram, coingecko, ...) **except** for exchange requests.
You can analyze the results of backtests and trading history easily using Jupyter notebooks. Sample notebooks are located at `user_data/notebooks/` after initializing the user directory with `freqtrade create-userdir --userdir user_data`.
You can analyze the results of backtests and trading history easily using Jupyter notebooks. Sample notebooks are located at `user_data/notebooks/` after initializing the user directory with `freqtrade create-userdir --userdir user_data`.
## Quick start with docker
Freqtrade provides a docker-compose file which starts up a jupyter lab server.
You can run this server using the following command: `docker-compose -f docker/docker-compose-jupyter.yml up`
You can run this server using the following command: `dockercompose -f docker/docker-compose-jupyter.yml up`
This will create a dockercontainer running jupyter lab, which will be accessible using `https://127.0.0.1:8888/lab`.
Please use the link that's printed in the console after startup for simplified login.
@@ -27,7 +27,7 @@ For this to work, first activate your virtual environment and run the following
Some tasks don't work especially well in notebooks. For example, anything using asynchronous execution is a problem for Jupyter. Also, freqtrade's primary entry point is the shell cli, so using pure python in a notebook bypasses arguments that provide required objects and parameters to helper functions. You may need to set those values or create expected objects manually.
## Recommended workflow
## Recommended workflow
| Task | Tool |
--- | ---
Bot operations | CLI
| Task | Tool |
--- | ---
Bot operations | CLI
Repetitive tasks | Shell scripts
Data analysis & visualization | Notebook
Data analysis & visualization | Notebook
1. Use the CLI to
* download historical data
* run a backtest
* run with real-time data
* export results
* export results
1. Collect these actions in shell scripts
* save complicated commands with arguments
* execute multi-step operations
* execute multi-step operations
* automate testing strategies and preparing data for analysis
1. Use a notebook to
* visualize data
* munge and plot to generate insights
* mangle and plot to generate insights
## Example utility snippets
## Example utility snippets
### Change directory to root
### Change directory to root
Jupyter notebooks execute from the notebook directory. The following snippet searches for the project root, so relative paths remain consistent.
@@ -80,7 +83,7 @@ from pathlib import Path
project_root = "somedir/freqtrade"
i=0
try:
os.chdirdir(project_root)
os.chdir(project_root)
assert Path('LICENSE').is_file()
except:
while i<4 and (not Path('LICENSE').is_file()):
@@ -119,5 +122,6 @@ Best avoid relative paths, since this starts at the storage location of the jupy
* [Strategy debugging](strategy_analysis_example.md) - also available as Jupyter notebook (`user_data/notebooks/strategy_analysis_example.ipynb`)
* [Plotting](plotting.md)
* [Tag Analysis](advanced-backtesting.md)
Feel free to submit an issue or Pull Request enhancing this document if you would like to share ideas on how to best analyze the data.
@@ -6,12 +6,12 @@ To download data (candles / OHLCV) needed for backtesting and hyperoptimization
If no additional parameter is specified, freqtrade will download data for `"1m"` and `"5m"` timeframes for the last 30 days.
Exchange and pairs will come from `config.json` (if specified using `-c/--config`).
Otherwise`--exchange` becomes mandatory.
Without provided configuration,`--exchange` becomes mandatory.
You can use a relative timerange (`--days 20`) or an absolute starting point (`--timerange 20200101-`). For incremental downloads, the relative approach should be used.
!!! Tip "Tip: Updating existing data"
If you already have backtesting data available in your data-directory and would like to refresh this data up to today, do not use `--days` or `--timerange` parameters. Freqtrade will keep the available data and only download the missing data.
If you already have backtesting data available in your data-directory and would like to refresh this data up to today, freqtrade will automatically calculate the data missing for the existing pairs and the download will occur from the latest available point until "now", neither --days or --timerange parameters are required. Freqtrade will keep the available data and only download the missing data.
If you are updating existing data after inserting new pairs that you have no data for, use `--new-pairs-days xx` parameter. Specified number of days will be downloaded for new pairs while old pairs will be updated with missing data only.
If you use `--days xx` parameter alone - data for specified number of days will be downloaded for _all_ pairs. Be careful, if specified number of days is smaller than gap between now and last downloaded candle - freqtrade will delete all existing data to avoid gaps in candle data.
--prepend Allow data prepending. (Data-appending is disabled)
Common arguments:
-v, --verbose Verbose mode (-vv for more, -vvv to get all messages).
--logfile FILE Log to the file specified. Special values are:
--logfile FILE, --log-file FILE
Log to the file specified. Special values are:
'syslog', 'journald'. See the documentation for more
details.
-V, --version show program's version number and exit
@@ -68,30 +76,94 @@ Common arguments:
`userdir/config.json` or `config.json` whichever
exists). Multiple --config options may be used. Can be
set to `-` to read config from stdin.
-d PATH, --datadir PATH
-d PATH, --datadir PATH, --data-dir PATH
Path to directory with historical backtesting data.
--userdir PATH, --user-data-dir PATH
Path to userdata directory.
```
!!! Tip "Downloading all data for one quote currency"
Often, you'll want to download data for all pairs of a specific quote-currency. In such cases, you can use the following shorthand:
`freqtrade download-data --exchange binance --pairs .*/USDT <...>`. The provided "pairs" string will be expanded to contain all active pairs on the exchange.
To also download data for inactive (delisted) pairs, add `--include-inactive-pairs` to the command.
!!! Note "Startup period"
`download-data` is a strategy-independent command. The idea is to download a big chunk of data once, and then iteratively increase the amount of data stored.
For that reason, `download-data` does not care about the "startup-period" defined in a strategy. It's up to the user to download additional days if the backtest should start at a specific point in time (while respecting startup period).
### Start download
A very simple command (assuming an available `config.json` file) can look as follows.
```bash
freqtrade download-data --exchange binance
```
This will download historical candle (OHLCV) data for all the currency pairs defined in the configuration.
* To use a different directory than the exchange specific default, use `--datadir user_data/data/some_directory`.
* To change the exchange used to download the historical data from, please use a different configuration file (you'll probably need to adjust rate limits etc.)
* To use `pairs.json` from some other directory, use `--pairs-file some_other_dir/pairs.json`.
* To download historical candle (OHLCV) data for only 10 days, use `--days 10` (defaults to 30 days).
* To download historical candle (OHLCV) data from a fixed starting point, use `--timerange 20200101-` - which will download all data from January 1st, 2020.
* Use `--timeframes` to specify what timeframe download the historical candle (OHLCV) data for. Default is `--timeframes 1m 5m` which will download 1-minute and 5-minute data.
* To use exchange, timeframe and list of pairs as defined in your configuration file, use the `-c/--config` option. With this, the script uses the whitelist defined in the config as the list of currency pairs to download data for and does not require the pairs.json file. You can combine `-c/--config` with most other options.
??? Note "Permission denied errors"
If your configuration directory `user_data` was made by docker, you may get the following error:
Freqtrade will ignore the end-date in this mode if data is available, updating the end-date to the existing data start point.
### Data format
Freqtrade currently supports 3 data-formats for both OHLCV and trades data:
Freqtrade currently supports the following data-formats:
*`json` (plain "text" json files)
*`jsongz` (a gzip-zipped version of json files)
*`hdf5` (a high performance datastore)
* `json` - plain "text" json files
* `jsongz` - a gzip-zipped version of json files
* `hdf5` - a high performance datastore
* `feather` - a dataformat based on Apache Arrow
* `parquet` - columnar datastore (OHLCV only)
By default, OHLCV data is stored as `json` data, while trades data is stored as `jsongz` data.
This can be changed via the `--data-format-ohlcv` and `--data-format-trades` command line arguments respectively.
To persist this change, you can should also add the following snippet to your configuration, so you don't have to insert the above arguments each time:
To persist this change, you should also add the following snippet to your configuration, so you don't have to insert the above arguments each time:
``` jsonc
// ...
@@ -105,182 +177,53 @@ If the default data-format has been changed during download, then the keys `data
!!! Note
You can convert between data-formats using the [convert-data](#sub-command-convert-data) and [convert-trade-data](#sub-command-convert-trade-data) methods.
#### Sub-command convert data
#### Dataformat comparison
The following comparisons have been made with the following data, and by using the linux `time` command.
The following command will convert all candle (OHLCV) data available in `~/.freqtrade/data/binance` from json to jsongz, saving diskspace in the process.
It'll also remove original json data files (`--erase` parameter).
Timings have been taken in a not very scientific way with the following command, which forces reading the data into memory.
You can fix the permissions of your user-data directory as follows:
```
sudo chown -R $UID:$GID user_data
touch user_data/data/binance/pairs.json
```
The format of the `pairs.json` file is a simple json list.
@@ -295,32 +238,243 @@ Mixing different stake-currencies is allowed for this file, since it's only used
]
```
### Start download
!!! Note
The `pairs.json` file is only used when no configuration is loaded (implicitly by naming, or via `--config` flag).
You can force the usage of this file via `--pairs-file pairs.json` - however we recommend to use the pairlist from within the configuration, either via `exchange.pair_whitelist` or `pairs` setting in the configuration.
-v, --verbose Verbose mode (-vv for more, -vvv to get all messages).
--logfile FILE, --log-file FILE
Log to the file specified. Special values are:
'syslog', 'journald'. See the documentation for more
details.
-V, --version show program's version number and exit
-c PATH, --config PATH
Specify configuration file (default:
`userdir/config.json` or `config.json` whichever
exists). Multiple --config options may be used. Can be
set to `-` to read config from stdin.
-d PATH, --datadir PATH, --data-dir PATH
Path to directory with historical backtesting data.
--userdir PATH, --user-data-dir PATH
Path to userdata directory.
```
This will download historical candle (OHLCV) data for all the currency pairs you defined in `pairs.json`.
### Example converting data
### Other Notes
The following command will convert all candle (OHLCV) data available in `~/.freqtrade/data/binance` from json to jsongz, saving diskspace in the process.
It'll also remove original json data files (`--erase` parameter).
- To use a different directory than the exchange specific default, use `--datadir user_data/data/some_directory`.
- To change the exchange used to download the historical data from, please use a different configuration file (you'll probably need to adjust rate limits etc.)
- To use `pairs.json` from some other directory, use `--pairs-file some_other_dir/pairs.json`.
- To download historical candle (OHLCV) data for only 10 days, use `--days 10` (defaults to 30 days).
- To download historical candle (OHLCV) data from a fixed starting point, use `--timerange 20200101-` - which will download all data from January 1st, 2020. Eventually set end dates are ignored.
- Use `--timeframes` to specify what timeframe download the historical candle (OHLCV) data for. Default is `--timeframes 1m 5m` which will download 1-minute and 5-minute data.
- To use exchange, timeframe and list of pairs as defined in your configuration file, use the `-c/--config` option. With this, the script uses the whitelist defined in the config as the list of currency pairs to download data for and does not require the pairs.json file. You can combine `-c/--config` with most other options.
By default, `download-data` sub-command downloads Candles (OHLCV) data. Some exchanges also provide historic trade-data via their API.
This data can be useful if you need many different timeframes, since it is only downloaded once, and then resampled locally to the desired timeframes.
Since this data is large by default, the files use gzip by default. They are stored in your data-directory with the naming convention of `<pair>-trades.json.gz` (`ETH_BTC-trades.json.gz`). Incremental mode is also supported, as for historic OHLCV data, so downloading the data once per week with `--days 8` will create an incremental data-repository.
Since this data is large by default, the files use the feather fileformat by default. They are stored in your data-directory with the naming convention of `<pair>-trades.feather` (`ETH_BTC-trades.feather`). Incremental mode is also supported, as for historic OHLCV data, so downloading the data once per week with `--days 8` will create an incremental data-repository.
To use this mode, simply add `--dl-trades` to your call. This will swap the download method to download trades, and resamples the data locally.
@@ -15,8 +15,8 @@ This command line option was deprecated in 2019.7-dev (develop branch) and remov
### The **--dynamic-whitelist** command line option
This command line option was deprecated in 2018 and removed freqtrade 2019.6-dev (develop branch)
and in freqtrade 2019.7.
This command line option was deprecated in 2018 and removed freqtrade 2019.6-dev (develop branch) and in freqtrade 2019.7.
Please refer to [pairlists](plugins.md#pairlists-and-pairlist-handlers) instead.
### the `--live` command line option
@@ -24,6 +24,10 @@ and in freqtrade 2019.7.
Did only download the latest 500 candles, so was ineffective in getting good backtest data.
Removed in 2019-7-dev (develop branch) and in freqtrade 2019.8.
### `ticker_interval` (now `timeframe`)
Support for `ticker_interval` terminology was deprecated in 2020.6 in favor of `timeframe` - and compatibility code was removed in 2022.3.
### Allow running multiple pairlists in sequence
The former `"pairlist"` section in the configuration has been removed, and is replaced by `"pairlists"` - being a list to specify a sequence of pairlists.
@@ -33,3 +37,45 @@ The old section of configuration parameters (`"pairlist"`) has been deprecated i
### deprecation of bidVolume and askVolume from volume-pairlist
Since only quoteVolume can be compared between assets, the other options (bidVolume, askVolume) have been deprecated in 2020.4, and have been removed in 2020.9.
### Using order book steps for exit price
Using `order_book_min` and `order_book_max` used to allow stepping the orderbook and trying to find the next ROI slot - trying to place sell-orders early.
As this does however increase risk and provides no benefit, it's been removed for maintainability purposes in 2021.7.
### Legacy Hyperopt mode
Using separate hyperopt files was deprecated in 2021.4 and was removed in 2021.9.
Please switch to the new [Parametrized Strategies](hyperopt.md) to benefit from the new hyperopt interface.
## Strategy changes between V2 and V3
Isolated Futures / short trading was introduced in 2022.4. This required major changes to configuration settings, strategy interfaces, ...
We have put a great effort into keeping compatibility with existing strategies, so if you just want to continue using freqtrade in spot markets, there are no changes necessary.
While we may drop support for the current interface sometime in the future, we will announce this separately and have an appropriate transition period.
Please follow the [Strategy migration](strategy_migration.md) guide to migrate your strategy to the new format to start using the new functionalities.
### webhooks - changes with 2022.4
#### `buy_tag` has been renamed to `enter_tag`
This should apply only to your strategy and potentially to webhooks.
We will keep a compatibility layer for 1-2 versions (so both `buy_tag` and `enter_tag` will still work), but support for this in webhooks will disappear after that.
#### Naming changes
Webhook terminology changed from "sell" to "exit", and from "buy" to "entry", removing "webhook" in the process.
version 2023.3 saw the removal of `populate_any_indicators` in favor of split methods for feature engineering and targets. Please read the [migration document](strategy_migration.md#freqai-strategy) for full details.
This page is intended for developers of Freqtrade, people who want to contribute to the Freqtrade codebase or documentation, or people who want to understand the source code of the application they're running.
All contributions, bug reports, bug fixes, documentation improvements, enhancements and ideas are welcome. We [track issues](https://github.com/freqtrade/freqtrade/issues) on [GitHub](https://github.com) and also have a dev channel on [discord](https://discord.gg/p7nuUNVfP7) or [slack](https://join.slack.com/t/highfrequencybot/shared_invite/zt-mm786y93-Fxo37glxMY9g8OQC5AoOIw) where you can ask questions.
All contributions, bug reports, bug fixes, documentation improvements, enhancements and ideas are welcome. We [track issues](https://github.com/freqtrade/freqtrade/issues) on [GitHub](https://github.com) and also have a dev channel on [discord](https://discord.gg/p7nuUNVfP7) where you can ask questions.
## Documentation
Documentation is available at [https://freqtrade.io](https://www.freqtrade.io/) and needs to be provided with every new feature PR.
Special fields for the documentation (like Note boxes, ...) can be found [here](https://squidfunk.github.io/mkdocs-material/extensions/admonition/).
Special fields for the documentation (like Note boxes, ...) can be found [here](https://squidfunk.github.io/mkdocs-material/reference/admonitions/).
To test the documentation locally use the following commands.
@@ -24,7 +24,12 @@ This will spin up a local server (usually on port 8000) so you can see if everyt
To configure a development environment, you can either use the provided [DevContainer](#devcontainer-setup), or use the `setup.sh` script and answer "y" when asked "Do you want to install dependencies for dev [y/N]? ".
Alternatively (e.g. if your system is not supported by the setup.sh script), follow the manual installation process and run `pip3 install -e .[all]`.
This will install all required tools for development, including `pytest`, `flake8`, `mypy`, and `coveralls`.
This will install all required tools for development, including `pytest`, `ruff`, `mypy`, and `coveralls`.
Then install the git hook scripts by running `pre-commit install`, so your changes will be verified locally before committing.
This avoids a lot of waiting for CI already, as some basic formatting checks are done locally on your machine.
Before opening a pull request, please familiarize yourself with our [Contributing Guidelines](https://github.com/freqtrade/freqtrade/blob/develop/CONTRIBUTING.md).
### Devcontainer setup
@@ -44,6 +49,13 @@ For more information about the [Remote container extension](https://code.visuals
New code should be covered by basic unittests. Depending on the complexity of the feature, Reviewers may request more in-depth unittests.
If necessary, the Freqtrade team can assist and give guidance with writing good tests (however please don't expect anyone to write the tests for you).
#### How to run tests
Use `pytest` in root folder to run all available testcases and confirm your local environment is setup correctly
!!! Note "feature branches"
Tests are expected to pass on the `develop` and `stable` branches. Other branches may be work in progress with tests not working yet.
#### Checking log content in tests
Freqtrade uses 2 main methods to check log content in tests, `log_has()` and `log_has_re()` (to check using regex, in case of dynamic log-messages).
To debug freqtrade, we recommend VSCode (with the Python extension) with the following launch configuration (located in `.vscode/launch.json`).
Details will obviously vary between setups - but this should work to get you started.
``` json
{
"name": "freqtrade trade",
"type": "python",
"request": "launch",
"module": "freqtrade",
"console": "integratedTerminal",
"args": [
"trade",
// Optional:
// "--userdir", "user_data",
"--strategy",
"MyAwesomeStrategy",
]
},
```
Command line arguments can be added in the `"args"` array.
This method can also be used to debug a strategy, by setting the breakpoints within the strategy.
A similar setup can also be taken for Pycharm - using `freqtrade` as module name, and setting the command line arguments as "parameters".
??? Tip "Correct venv usage"
When using a virtual environment (which you should), make sure that your Editor is using the correct virtual environment to avoid problems or "unknown import" errors.
#### Vscode
You can select the correct environment in VSCode with the command "Python: Select Interpreter" - which will show you environments the extension detected.
If your environment has not been detected, you can also pick a path manually.
#### Pycharm
In pycharm, you can select the appropriate Environment in the "Run/Debug Configurations" window.
This assumes that you have the repository checked out, and the editor is started at the repository root level (so setup.py is at the top level of your repository).
## ErrorHandling
Freqtrade Exceptions all inherit from `FreqtradeException`.
@@ -195,11 +250,12 @@ For that reason, they must implement the following methods:
* `global_stop()`
* `stop_per_pair()`.
`global_stop()` and `stop_per_pair()` must return a ProtectionReturn tuple, which consists of:
`global_stop()` and `stop_per_pair()` must return a ProtectionReturn object, which consists of:
* lock pair - boolean
* lock until - datetime - until when should the pair be locked (will be rounded up to the next new candle)
* reason - string, used for logging and storage in the database
* lock_side - long, short or '*'.
The `until` portion should be calculated using the provided `calculate_lock_end()` method.
@@ -218,13 +274,13 @@ Protections can have 2 different ways to stop trading for a limited :
##### Protections - per pair
Protections that implement the per pair approach must set `has_local_stop=True`.
The method `stop_per_pair()` will be called whenever a trade closed (sell order completed).
The method `stop_per_pair()` will be called whenever a trade closed (exit order completed).
##### Protections - global protection
These Protections should do their evaluation across all pairs, and consequently will also lock all pairs from trading (called a global PairLock).
Global protection must set `has_global_stop=True` to be evaluated for global stops.
The method `global_stop()` will be called whenever a trade closed (sell order completed).
The method `global_stop()` will be called whenever a trade closed (exit order completed).
##### Protections - calculating lock end time
@@ -240,11 +296,34 @@ The `IProtection` parent class provides a helper method for this in `calculate_l
!!! Note
This section is a Work in Progress and is not a complete guide on how to test a new exchange with Freqtrade.
!!! Note
Make sure to use an up-to-date version of CCXT before running any of the below tests.
You can get the latest version of ccxt by running `pip install -U ccxt` with activated virtual environment.
Native docker is not supported for these tests, however the available dev-container will support all required actions and eventually necessary changes.
Most exchanges supported by CCXT should work out of the box.
To quickly test the public endpoints of an exchange, add a configuration for your exchange to `test_ccxt_compat.py` and run these tests with `pytest --longrun tests/exchange/test_ccxt_compat.py`.
Completing these tests successfully a good basis point (it's a requirement, actually), however these won't guarantee correct exchange functioning, as this only tests public endpoints, but no private endpoint (like generate order or similar).
Also try to use `freqtrade download-data` for an extended timerange (multiple months) and verify that the data downloaded correctly (no holes, the specified timerange was actually downloaded).
These are prerequisites to have an exchange listed as either Supported or Community tested (listed on the homepage).
The below are "extras", which will make an exchange better (feature-complete) - but are not absolutely necessary for either of the 2 categories.
Additional tests / steps to complete:
* Verify data provided by `fetch_ohlcv()` - and eventually adjust `ohlcv_candle_limit` for this exchange
* Check L2 orderbook limit range (API documentation) - and eventually set as necessary
* Check if balance shows correctly (*)
* Create market order (*)
* Create limit order (*)
* Complete trade (enter + exit) (*)
* Compare result calculation between exchange and bot
* Ensure fees are applied correctly (check the database against the exchange)
(*) Requires API keys and Balance on the exchange.
### Stoploss On Exchange
Check if the new exchange supports Stoploss on Exchange orders through their API.
@@ -261,18 +340,18 @@ To check how the new exchange behaves, you can use the following snippet:
``` python
import ccxt
from datetime import datetime
from datetime import datetime, timezone
from freqtrade.data.converter import ohlcv_to_dataframe
ct = ccxt.binance()
ct = ccxt.binance() # Use the exchange you're testing
timeframe = "1d"
pair = "XLM/BTC" # Make sure to use a pair that exists on that exchange!
pair = "BTC/USDT" # Make sure to use a pair that exists on that exchange!
@@ -285,6 +364,32 @@ The output will show the last entry from the Exchange as well as the current UTC
If the day shows the same day, then the last candle can be assumed as incomplete and should be dropped (leave the setting `"ohlcv_partial_candle"` from the exchange-class untouched / True). Otherwise, set `"ohlcv_partial_candle"` to `False` to not drop Candles (shown in the example above).
Another way is to run this command multiple times in a row and observe if the volume is changing (while the date remains the same).
### Update binance cached leverage tiers
Updating leveraged tiers should be done regularly - and requires an authenticated account with futures enabled.
``` python
import ccxt
import json
from pathlib import Path
exchange = ccxt.binance({
'apiKey': '<apikey>',
'secret': '<secret>'
'options': {'defaultType': 'swap'}
})
_ = exchange.load_markets()
lev_tiers = exchange.fetch_leverage_tiers()
# Assumes this is running in the root of the repository.
This documents some decisions taken for the CI Pipeline.
* CI runs on all OS variants, Linux (ubuntu), macOS and Windows.
* Docker images are build for the branches `stable` and `develop`.
* Docker images are build for the branches `stable` and `develop`, and are built as multiarch builds, supporting multiple platforms via the same tag.
* Docker images containing Plot dependencies are also available as `stable_plot` and `develop_plot`.
* Raspberry PI Docker images are postfixed with `_pi` - so tags will be `:stable_pi` and `develop_pi`.
* Docker images contain a file, `/freqtrade/freqtrade_commit` containing the commit this image is based of.
* Full docker image rebuilds are run once a week via schedule.
* Deployments run on ubuntu.
@@ -325,8 +429,9 @@ Determine if crucial bugfixes have been made between this commit and the current
* Merge the release branch (stable) into this branch.
* Edit `freqtrade/__init__.py` and add the version matching the current date (for example `2019.7` for July 2019). Minor versions can be `2019.7.1` should we need to do a second release that month. Version numbers must follow allowed versions from PEP0440 to avoid failures pushing to pypi.
* Commit this part
* push that branch to the remote and create a PR against the stable branch
* Commit this part.
* push that branch to the remote and create a PR against the stable branch.
* Update develop version to next version following the pattern `2019.8-dev`.
### Create changelog from git commits
@@ -349,6 +454,11 @@ To keep the release-log short, best wrap the full git changelog into a collapsib
</details>
```
### FreqUI release
If FreqUI has been updated substantially, make sure to create a release before merging the release branch.
Make sure that freqUI CI on the release is finished and passed before merging the release.
### Create github release / tag
Once the PR against stable is merged (best right after merging):
@@ -356,7 +466,13 @@ Once the PR against stable is merged (best right after merging):
* Use the button "Draft a new release" in the Github UI (subsection releases).
* Use the version-number specified as tag.
* Use "stable" as reference (this step comes after the above PR is merged).
* Use the above changelog as release comment (as codeblock)
* Use the above changelog as release comment (as codeblock).
To simplify running freqtrade, [`docker-compose`](https://docs.docker.com/compose/install/) should be installed and available to follow the below [docker quick start guide](#docker-quick-start).
!!! Info "Docker compose install"
Freqtrade documentation assumes the use of Docker desktop (or the docker compose plugin).
While the docker-compose standalone installation still works, it will require changing all `docker compose` commands from `docker compose` to `docker-compose` to work (e.g. `docker compose up -d` will become `docker-compose up -d`).
## Freqtrade with docker-compose
??? Warning "Docker on windows"
If you just installed docker on a windows system, make sure to reboot your system, otherwise you might encounter unexplainable Problems related to network connectivity to docker containers.
Freqtrade provides an official Docker image on [Dockerhub](https://hub.docker.com/r/freqtradeorg/freqtrade/), as well as a [docker-compose file](https://github.com/freqtrade/freqtrade/blob/stable/docker-compose.yml) ready for usage.
## Freqtrade with docker
Freqtrade provides an official Docker image on [Dockerhub](https://hub.docker.com/r/freqtradeorg/freqtrade/), as well as a [docker compose file](https://github.com/freqtrade/freqtrade/blob/stable/docker-compose.yml) ready for usage.
!!! Note
- The following section assumes that `docker`and `docker-compose` are installed and available to the logged in user.
- The following section assumes that `docker`is installed and available to the logged in user.
- All below commands use relative directories and will have to be executed from the directory containing the `docker-compose.yml` file.
### Docker quick start
Create a new directory and place the [docker-compose file](https://raw.githubusercontent.com/freqtrade/freqtrade/stable/docker-compose.yml) in this directory.
=== "PC/MAC/Linux"
``` bash
mkdir ft_userdata
cd ft_userdata/
# Download the docker-compose file from the repository
dockercompose run --rm freqtrade new-config --config user_data/config.json
```
The above snippet creates a new directory called `ft_userdata`, downloads the latest compose file and pulls the freqtrade image.
The last 2 steps in the snippet create the directory with `user_data`, as well as (interactively) the default configuration based on your selections.
@@ -117,7 +61,7 @@ The last 2 steps in the snippet create the directory with `user_data`, as well a
The `SampleStrategy` is run by default.
!!! Warning "`SampleStrategy` is just a demo!"
!!! Danger "`SampleStrategy` is just a demo!"
The `SampleStrategy` is there for your reference and give you ideas for your own strategy.
Please always backtest your strategy and use dry-run for some time before risking real money!
You will find more information about Strategy development in the [Strategy documentation](strategy-customization.md).
@@ -125,35 +69,47 @@ The `SampleStrategy` is run by default.
Once this is done, you're ready to launch the bot in trading mode (Dry-run or Live-trading, depending on your answer to the corresponding question you made above).
``` bash
docker-compose up -d
dockercompose up -d
```
!!! Warning "Default configuration"
While the configuration generated will be mostly functional, you will still need to verify that all options correspond to what you want (like Pricing, pairlist, ...) before starting the bot.
#### Accessing the UI
If you've selected to enable FreqUI in the `new-config` step, you will have freqUI available at port `localhost:8080`.
You can now access the UI by typing localhost:8080 in your browser.
??? Note "UI Access on a remote server"
If you're running on a VPS, you should consider using either a ssh tunnel, or setup a VPN (openVPN, wireguard) to connect to your bot.
This will ensure that freqUI is not directly exposed to the internet, which is not recommended for security reasons (freqUI does not support https out of the box).
Setup of these tools is not part of this tutorial, however many good tutorials can be found on the internet.
Please also read the [API configuration with docker](rest-api.md#configuration-with-docker) section to learn more about this configuration.
#### Monitoring the bot
You can check for running instances with `docker-compose ps`.
You can check for running instances with `dockercompose ps`.
This should list the service `freqtrade` as `running`. If that's not the case, best check the logs (see next point).
#### Docker-compose logs
#### Dockercompose logs
Logs will be written to: `user_data/logs/freqtrade.log`.
You can also check the latest log with the command `docker-compose logs -f`.
You can also check the latest log with the command `dockercompose logs -f`.
#### Database
The database will be located at: `user_data/tradesv3.sqlite`
#### Updating freqtrade with docker-compose
#### Updating freqtrade with docker
Updating freqtrade when using `docker-compose` is as simple as running the following 2 commands:
Updating freqtrade when using `docker` is as simple as running the following 2 commands:
``` bash
# Download the latest image
docker-compose pull
dockercompose pull
# Restart the image
docker-compose up -d
dockercompose up -d
```
This will first pull the latest image, and will then restart the container with the just pulled version.
@@ -165,32 +121,43 @@ This will first pull the latest image, and will then restart the container with
Advanced users may edit the docker-compose file further to include all possible options or arguments.
All freqtrade arguments will be available by running `docker-compose run --rm freqtrade <command><optionalarguments>`.
All freqtrade arguments will be available by running `dockercompose run --rm freqtrade <command><optionalarguments>`.
!!! Note "`docker-compose run --rm`"
!!! Warning "`dockercompose` for trade commands"
Trade commands (`freqtrade trade <...>`) should not be ran via `docker compose run` - but should use `docker compose up -d` instead.
This makes sure that the container is properly started (including port forwardings) and will make sure that the container will restart after a system reboot.
If you intend to use freqUI, please also ensure to adjust the [configuration accordingly](rest-api.md#configuration-with-docker), otherwise the UI will not be available.
!!! Note "`docker compose run --rm`"
Including `--rm` will remove the container after completion, and is highly recommended for all modes except trading mode (running with `freqtrade trade` command).
#### Example: Download data with docker-compose
??? Note "Using docker without dockercompose"
"`docker compose run --rm`" will require a compose file to be provided.
Some freqtrade commands that don't require authentication such as `list-pairs` can be run with "`docker run --rm`" instead.
For example `docker run --rm freqtradeorg/freqtrade:stable list-pairs --exchange binance --quote BTC --print-json`.
This can be useful for fetching exchange information to add to your `config.json` without affecting your running containers.
#### Example: Download data with docker
Download backtesting data for 5 days for the pair ETH/BTC and 1h timeframe from Binance. The data will be stored in the directory `user_data/data/` on the host.
Head over to the [Backtesting Documentation](backtesting.md) to learn more.
### Additional dependencies with docker-compose
### Additional dependencies with docker
If your strategy requires dependencies not included in the default image - it will be necessary to build the image on your host.
For this, please create a Dockerfile containing installation steps for the additional dependencies (have a look at [docker/Dockerfile.custom](https://github.com/freqtrade/freqtrade/blob/develop/docker/Dockerfile.custom) for an example).
@@ -204,26 +171,26 @@ You'll then also need to modify the `docker-compose.yml` file and uncomment the
dockerfile: "./Dockerfile.<yourextension>"
```
You can then run `docker-compose build` to build the docker image, and run it using the commands described above.
You can then run `dockercompose build --pull` to build the docker image, and run it using the commands described above.
## Plotting with docker-compose
### Plotting with docker
Commands `freqtrade plot-profit` and `freqtrade plot-dataframe` ([Documentation](plotting.md)) are available by changing the image to `*_plot` in your docker-compose.yml file.
Commands `freqtrade plot-profit` and `freqtrade plot-dataframe` ([Documentation](plotting.md)) are available by changing the image to `*_plot` in your `docker-compose.yml` file.
You can then use these commands as follows:
``` bash
docker-compose run --rm freqtrade plot-dataframe --strategy AwesomeStrategy -p BTC/ETH --timerange=20180801-20180805
dockercompose run --rm freqtrade plot-dataframe --strategy AwesomeStrategy -p BTC/ETH --timerange=20180801-20180805
```
The output will be stored in the `user_data/plot` directory, and can be opened with any modern browser.
## Data analysis using docker compose
### Data analysis using docker compose
Freqtrade provides a docker-compose file which starts up a jupyter lab server.
You can run this server using the following command:
``` bash
docker-compose -f docker/docker-compose-jupyter.yml up
dockercompose -f docker/docker-compose-jupyter.yml up
```
This will create a docker-container running jupyter lab, which will be accessible using `https://127.0.0.1:8888/lab`.
@@ -232,5 +199,28 @@ Please use the link that's printed in the console after startup for simplified l
Since part of this image is built on your machine, it is recommended to rebuild the image from time to time to keep freqtrade (and dependencies) up-to-date.
If you're on windows and just installed Docker (desktop), make sure to reboot your System. Docker can have problems with network connectivity without a restart.
You should obviously also make sure to have your [settings](#accessing-the-ui) accordingly.
!!! Warning
Due to the above, we do not recommend the usage of docker on windows for production setups, but only for experimentation, datadownload and backtesting.
Best use a linux-VPS for running freqtrade reliably.
The `Edge Positioning` module uses probability to calculate your win rate and risk reward ratio. It will use these statistics to control your strategy trade entry points, position size and, stoploss.
!!! Warning
WHen using `Edge positioning` with a dynamic whitelist (VolumePairList), make sure to also use `AgeFilter` and set it to at least `calculate_since_number_of_days` to avoid problems with missing data.
When using `Edge positioning` with a dynamic whitelist (VolumePairList), make sure to also use `AgeFilter` and set it to at least `calculate_since_number_of_days` to avoid problems with missing data.
!!! Note
`Edge Positioning` only considers *its own* buy/sell/stoploss signals. It ignores the stoploss, trailing stoploss, and ROI settings in the strategy configuration file.
However, the bot was tested by the development team with only a few exchanges.
A current list of these can be found in the "Home" section of this documentation.
Feel free to test other exchanges and submit your feedback or PR to improve the bot or confirm exchanges that work flawlessly..
Some exchanges require special configuration, which can be found below.
### Sample exchange configuration
A exchange configuration for "binance" would look as follows:
```json
"exchange":{
"name":"binance",
"key":"your_exchange_key",
"secret":"your_exchange_secret",
"ccxt_config":{},
"ccxt_async_config":{},
// ...
```
### Setting rate limits
Usually, rate limits set by CCXT are reliable and work well.
In case of problems related to rate-limits (usually DDOS Exceptions in your logs), it's easy to change rateLimit settings to other values.
```json
"exchange":{
"name":"kraken",
"key":"your_exchange_key",
"secret":"your_exchange_secret",
"ccxt_config":{"enableRateLimit":true},
"ccxt_async_config":{
"enableRateLimit":true,
"rateLimit":3100
},
```
This configuration enables kraken, as well as rate-limiting to avoid bans from the exchange.
`"rateLimit": 3100` defines a wait-event of 3.1s between each call. This can also be completely disabled by setting `"enableRateLimit"` to false.
!!! Note
Optimal settings for rate-limiting depend on the exchange and the size of the whitelist, so an ideal parameter will vary on many other settings.
We try to provide sensible defaults per exchange where possible, if you encounter bans please make sure that `"enableRateLimit"` is enabled and increase the `"rateLimit"` parameter step by step.
## Binance
!!! Warning "Server location and geo-ip restrictions"
Please be aware that binance restrict api access regarding the server country. The currents and non exhaustive countries blocked are United States, Malaysia (Singapour), Ontario (Canada). Please go to [binance terms > b. Eligibility](https://www.binance.com/en/terms) to find up to date list.
Binance supports `stoploss_on_exchange` and uses stop-loss-limit orders. It provides great advantages, so we recommend to benefit from it.
Binance supports `stoploss_on_exchange` and uses `stop-loss-limit` orders. It provides great advantages, so we recommend to benefit from it by enabling stoploss on exchange.
On futures, Binance supports both `stop-limit` as well as `stop-market` orders. You can use either `"limit"` or `"market"` in the `order_types.stoploss` configuration setting to decide which type to use.
### Binance Blacklist
### Binance Blacklist recommendation
For Binance, please add `"BNB/<STAKE>"` to your blacklist to avoid issues.
Accounts having BNB accounts use this to pay for fees - if your first trade happens to be on `BNB`, further trades will consume this position and make the initial BNB trade unsellable as the expected amount is not there anymore.
For Binance, it is suggested to add `"BNB/<STAKE>"` to your blacklist to avoid issues, unless you are willing to maintain enough extra `BNB` on the account or unless you're willing to disable using `BNB` for fees.
Binance accounts may use `BNB` for fees, and if a trade happens to be on `BNB`, further trades may consume this position and make the initial BNB trade unsellable as the expected amount is not there anymore.
### Binance sites
@@ -19,6 +75,56 @@ Binance has been split into 2, and users must use the correct ccxt exchange ID f
* [binance.com](https://www.binance.com/) - International users. Use exchange id: `binance`.
* [binance.us](https://www.binance.us/) - US based users. Use exchange id: `binanceus`.
They can however also be configured via configuration file. Since json doesn't support multi-line strings, you'll have to replace all newlines with `\n` to have a valid json file.
Binance has specific (unfortunately complex) [Futures Trading Quantitative Rules](https://www.binance.com/en/support/faq/4f462ebe6ff445d4a170be7d9e897272) which need to be followed, and which prohibit a too low stake-amount (among others) for too many orders.
Violating these rules will result in a trading restriction.
When trading on Binance Futures market, orderbook must be used because there is no price ticker data for futures.
``` jsonc
"entry_pricing": {
"use_order_book": true,
"order_book_top": 1,
"check_depth_of_market": {
"enabled": false,
"bids_to_ask_delta": 1
}
},
"exit_pricing": {
"use_order_book": true,
"order_book_top": 1
},
```
#### Binance futures settings
Users will also have to have the futures-setting "Position Mode" set to "One-way Mode", and "Asset Mode" set to "Single-Asset Mode".
These settings will be checked on startup, and freqtrade will show an error if this setting is wrong.
Freqtrade will not attempt to change these settings.
## Kraken
!!! Tip "Stoploss on Exchange"
@@ -56,6 +162,12 @@ Bittrex does not support market orders. If you have a message at the bot startup
Bittrex also does not support `VolumePairlist` due to limited / split API constellation at the moment.
Please use `StaticPairlist`. Other pairlists (other than `VolumePairlist`) should not be affected.
### Volume pairlist
Bittrex does not support the direct usage of VolumePairList. This can however be worked around by using the advanced mode with `lookback_days: 1` (or more), which will emulate 24h volume.
Read more in the [pairlist documentation](plugins.md#volumepairlist-advanced-mode).
### Restricted markets
Bittrex split its exchange into US and International versions.
@@ -77,34 +189,15 @@ You can get a list of restricted markets by using the following snippet:
``` python
import ccxt
ct = ccxt.bittrex()
_ = ct.load_markets()
res = [ f"{x['MarketCurrency']}/{x['BaseCurrency']}" for x in ct.publicGetMarkets()['result'] if x['IsRestricted']]
lm = ct.load_markets()
res = [p for p, x in lm.items() if 'US' in x['info']['prohibitedIn']]
print(res)
```
## FTX
!!! Tip "Stoploss on Exchange"
FTX supports `stoploss_on_exchange` and can use both stop-loss-market and stop-loss-limit orders. It provides great advantages, so we recommend to benefit from it.
You can use either `"limit"` or `"market"` in the `order_types.stoploss` configuration setting to decide which type of stoploss shall be used.
### Using subaccounts
To use subaccounts with FTX, you need to edit the configuration and add the following:
``` json
"exchange": {
"ccxt_config": {
"headers": {
"FTX-SUBACCOUNT": "name"
}
},
}
```
## Kucoin
Kucoin requries a passphrase for each api key, you will therefore need to add this key into the configuration so your exchange section looks as follows:
Kucoin requires a passphrase for each api key, you will therefore need to add this key into the configuration so your exchange section looks as follows:
```json
"exchange": {
@@ -112,12 +205,74 @@ Kucoin requries a passphrase for each api key, you will therefore need to add th
Kucoin supports `stoploss_on_exchange` and can use both stop-loss-market and stop-loss-limit orders. It provides great advantages, so we recommend to benefit from it.
You can use either `"limit"` or `"market"` in the `order_types.stoploss` configuration setting to decide which type of stoploss shall be used.
### Kucoin Blacklists
For Kucoin, please add `"KCS/<STAKE>"` to your blacklist to avoid issues.
Accounts having KCS accounts use this to pay for fees - if your first trade happens to be on `KCS`, further trades will consume this position and make the initial KCS trade unsellable as the expected amount is not there anymore.
For Kucoin, it is suggested to add `"KCS/<STAKE>"` to your blacklist to avoid issues, unless you are willing to maintain enough extra `KCS` on the account or unless you're willing to disable using `KCS` for fees.
Kucoin accounts may use `KCS` for fees, and if a trade happens to be on `KCS`, further trades may consume this position and make the initial `KCS` trade unsellable as the expected amount is not there anymore.
## Huobi
!!! Tip "Stoploss on Exchange"
Huobi supports `stoploss_on_exchange` and uses `stop-limit` orders. It provides great advantages, so we recommend to benefit from it by enabling stoploss on exchange.
## OKX (former OKEX)
OKX requires a passphrase for each api key, you will therefore need to add this key into the configuration so your exchange section looks as follows:
```json
"exchange": {
"name": "okx",
"key": "your_exchange_key",
"secret": "your_exchange_secret",
"password": "your_exchange_api_key_password",
// ...
}
```
!!! Warning
OKX only provides 100 candles per api call. Therefore, the strategy will only have a pretty low amount of data available in backtesting mode.
!!! Warning "Futures"
OKX Futures has the concept of "position mode" - which can be "Buy/Sell" or long/short (hedge mode).
Freqtrade supports both modes (we recommend to use Buy/Sell mode) - but changing the mode mid-trading is not supported and will lead to exceptions and failures to place trades.
OKX also only provides MARK candles for the past ~3 months. Backtesting futures prior to that date will therefore lead to slight deviations, as funding-fees cannot be calculated correctly without this data.
## Gate.io
!!! Tip "Stoploss on Exchange"
Gate.io supports `stoploss_on_exchange` and uses `stop-loss-limit` orders. It provides great advantages, so we recommend to benefit from it by enabling stoploss on exchange..
Gate.io allows the use of `POINT` to pay for fees. As this is not a tradable currency (no regular market available), automatic fee calculations will fail (and default to a fee of 0).
The configuration parameter `exchange.unknown_fee_rate` can be used to specify the exchange rate between Point and the stake currency. Obviously, changing the stake-currency will also require changes to this value.
## Bybit
Futures trading on bybit is currently supported for USDT markets, and will use isolated futures mode.
Users with unified accounts (there's no way back) can create a Sub-account which will start as "non-unified", and can therefore use isolated futures.
On startup, freqtrade will set the position mode to "One-way Mode" for the whole (sub)account. This avoids making this call over and over again (slowing down bot operations), but means that changes to this setting may result in exceptions and errors
As bybit doesn't provide funding rate history, the dry-run calculation is used for live trades as well.
API Keys for live futures trading (Subaccount on non-unified) must have the following permissions:
* Read-write
* Contract - Orders
* Contract - Positions
We do strongly recommend to limit all API keys to the IP you're going to use it from.
!!! Tip "Stoploss on Exchange"
Bybit (futures only) supports `stoploss_on_exchange` and uses `stop-loss-limit` orders. It provides great advantages, so we recommend to benefit from it by enabling stoploss on exchange.
On futures, Bybit supports both `stop-limit` as well as `stop-market` orders. You can use either `"limit"` or `"market"` in the `order_types.stoploss` configuration setting to decide which type to use.
## All exchanges
@@ -154,9 +309,11 @@ For example, to test the order type `FOK` with Kraken, and modify candle limit t
Freqtrade supports spot trading, as well as (isolated) futures trading for some selected exchanges. Please refer to the [documentation start page](index.md#supported-futures-exchanges-experimental) for an uptodate list of supported exchanges.
### Can I open short positions?
### Can my bot open short positions?
No, Freqtrade does not support trading with margin / leverage, and cannot open short positions.
Freqtrade can open short positions in futures markets.
This requires the strategy to be made for this - and `"trading_mode": "futures"` in the configuration.
Please make sure to read the [relevant documentation page](leverage.md) first.
In some cases, your exchange may provide leveraged spot tokens which can be traded with Freqtrade eg. BTCUP/USD, BTCDOWN/USD, ETHBULL/USD, ETHBEAR/USD, etc...
In spot markets, you can in some cases use leveraged spot tokens, which reflect an inverted pair (eg. BTCUP/USD, BTCDOWN/USD, ETHBULL/USD, ETHBEAR/USD,...) which can be traded with Freqtrade.
### Can I trade options or futures?
### Can my bot trade options or futures?
No, options and futures trading are not supported.
Futures trading is supported for selected exchanges. Please refer to the [documentation start page](index.md#supported-futures-exchanges-experimental) for an uptodate list of supported exchanges.
## Beginner Tips & Tricks
* When you work with your strategy & hyperopt file you should use a proper code editor like VSCode or PyCharm. A good code editor will provide syntax highlighting as well as line numbers, making it easy to find syntax errors (most likely pointed out by Freqtrade during startup).
## Freqtrade common issues
## Freqtrade common questions
### Can freqtrade open multiple positions on the same pair in parallel?
No. Freqtrade will only open one position per pair at a time.
You can however use the [`adjust_trade_position()` callback](strategy-callbacks.md#adjust-trade-position) to adjust an open position.
Backtesting provides an option for this in `--eps` - however this is only there to highlight "hidden" signals, and will not work in live.
### The bot does not start
@@ -27,8 +36,8 @@ Running the bot with `freqtrade trade --config config.json` shows the output `fr
This could be caused by the following reasons:
* The virtual environment is not active.
* Run `source .env/bin/activate` to activate the virtual environment.
* The installation did not work correctly.
* Run `source .venv/bin/activate` to activate the virtual environment.
* The installation did not complete successfully.
* Please check the [Installation documentation](installation.md).
### I have waited 5 minutes, why hasn't the bot made any trades yet?
@@ -42,7 +51,7 @@ position for a trade. Be patient!
### I have made 12 trades already, why is my total profit negative?
I understand your disappointment but unfortunately 12 trades is just
not enough to say anything. If you run backtesting, you can see that our
not enough to say anything. If you run backtesting, you can see that the
current algorithm does leave you on the plus side, but that is after
thousands of trades and even there, you will be left with losses on
specific coins that you have traded tens if not hundreds of times. We
@@ -54,13 +63,38 @@ you can't say much from few trades.
Yes. You can edit your config and use the `/reload_config` command to reload the configuration. The bot will stop, reload the configuration and strategy and will restart with the new configuration and strategy.
### I want to improve the bot with a new strategy
### Why does my bot not sell everything it bought?
That's great. We have a nice backtesting and hyperoptimization setup. See the tutorial [here|Testing-new-strategies-with-Hyperopt](bot-usage.md#hyperopt-commands).
This is called "coin dust" and can happen on all exchanges.
It happens because many exchanges subtract fees from the "receiving currency" - so you buy 100 COIN - but you only get 99.9 COIN.
As COIN is trading in full lot sizes (1COIN steps), you cannot sell 0.9 COIN (or 99.9 COIN) - but you need to round down to 99 COIN.
### Is there a setting to only SELL the coins being held and not perform anymore BUYS?
This is not a bot-problem, but will also happen while manual trading.
You can use the `/stopbuy` command in Telegram to prevent future buys, followed by `/forcesell all` (sell all open trades).
While freqtrade can handle this (it'll sell 99 COIN), fees are often below the minimum tradable lot-size (you can only trade full COIN, not 0.9 COIN).
Leaving the dust (0.9 COIN) on the exchange makes usually sense, as the next time freqtrade buys COIN, it'll eat into the remaining small balance, this time selling everything it bought, and therefore slowly declining the dust balance (although it most likely will never reach exactly 0).
Where possible (e.g. on binance), the use of the exchange's dedicated fee currency will fix this.
On binance, it's sufficient to have BNB in your account, and have "Pay fees in BNB" enabled in your profile. Your BNB balance will slowly decline (as it's used to pay fees) - but you'll no longer encounter dust (Freqtrade will include the fees in the profit calculations).
Other exchanges don't offer such possibilities, where it's simply something you'll have to accept or move to a different exchange.
### I deposited more funds to the exchange, but my bot doesn't recognize this
Freqtrade will update the exchange balance when necessary (Before placing an order).
RPC calls (Telegram's `/balance`, API calls to `/balance`) can trigger an update at max. once per hour.
If `adjust_trade_position` is enabled (and the bot has open trades eligible for position adjustments) - then the wallets will be refreshed once per hour.
To force an immediate update, you can use `/reload_config` - which will restart the bot.
### I want to use incomplete candles
Freqtrade will not provide incomplete candles to strategies. Using incomplete candles will lead to repainting and consequently to strategies with "ghost" buys, which are impossible to both backtest, and verify after they happened.
You can use "current" market data by using the [dataprovider](strategy-customization.md#orderbookpair-maximum)'s orderbook or ticker methods - which however cannot be used during backtesting.
### Is there a setting to only Exit the trades being held and not perform any new Entries?
You can use the `/stopentry` command in Telegram to prevent future trade entry, followed by `/forceexit all` (sell all open trades).
### I want to run multiple bots on the same machine
@@ -76,28 +110,53 @@ If this happens for all pairs in the pairlist, this might indicate a recent exch
Irrespectively of the reason, Freqtrade will fill up these candles with "empty" candles, where open, high, low and close are set to the previous candle close - and volume is empty. In a chart, this will look like a `_` - and is aligned with how exchanges usually represent 0 volume candles.
### I'm getting "Price jump between 2 candles detected"
This message is a warning that the candles had a price jump of > 30%.
This might be a sign that the pair stopped trading, and some token exchange took place (e.g. COCOS in 2021 - where price jumped from 0.0000154 to 0.01621).
This message is often accompanied by ["Missing data fillup"](#im-getting-missing-data-fillup-messages-in-the-log) - as trading on such pairs is often stopped for some time.
### I'm getting "Outdated history for pair xxx" in the log
The bot is trying to tell you that it got an outdated last candle (not the last complete candle).
As a consequence, Freqtrade will not enter a trade for this pair - as trading on old information is usually not what is desired.
This warning can point to one of the below problems:
* Exchange downtime -> Check your exchange status page / blog / twitter feed for details.
* Wrong system time -> Ensure your system-time is correct.
* Barely traded pair -> Check the pair on the exchange webpage, look at the timeframe your strategy uses. If the pair does not have any volume in some candles (usually visualized with a "volume 0" bar, and a "_" as candle), this pair did not have any trades in this timeframe. These pairs should ideally be avoided, as they can cause problems with order-filling.
* API problem -> API returns wrong data (this only here for completeness, and should not happen with supported exchanges).
### I'm getting the "RESTRICTED_MARKET" message in the log
Currently known to happen for US Bittrex users.
Currently known to happen for US Bittrex users.
Read [the Bittrex section about restricted markets](exchanges.md#restricted-markets) for more information.
### I'm getting the "Exchange Bittrex does not support market orders." message and cannot run my strategy
### I'm getting the "Exchange XXX does not support market orders." message and cannot run my strategy
As the message says, Bittrex does not support market orders and you have one of the [order types](configuration.md/#understand-order_types) set to "market". Your strategy was probably written with other exchanges in mind and sets "market" orders for "stoploss" orders, which is correct and preferable for most of the exchanges supporting market orders (but not for Bittrex).
As the message says, your exchange does not support market orders and you have one of the [order types](configuration.md/#understand-order_types) set to "market". Your strategy was probably written with other exchanges in mind and sets "market" orders for "stoploss" orders, which is correct and preferable for most of the exchanges supporting market orders (but not for Bittrex and Gate.io).
To fix it for Bittrex, redefine order types in the strategy to use "limit" instead of "market":
To fix this, redefine order types in the strategy to use "limit" instead of "market":
```
``` python
order_types = {
...
'stoploss': 'limit',
"stoploss": "limit",
...
}
```
The same fix should be applied in the configuration file, if order types are defined in your custom config rather than in the strategy.
### I'm trying to start the bot live, but get an API permission error
Errors like `Invalid API-key, IP, or permissions for action` mean exactly what they actually say.
Your API key is either invalid (copy/paste error? check for leading/trailing spaces in the config), expired, or the IP you're running the bot from is not enabled in the Exchange's API console.
Usually, the permission "Spot Trading" (or the equivalent in the exchange you use) will be necessary.
Futures will usually have to be enabled specifically.
### How do I search the bot logs for something?
By default, the bot writes its log into stderr stream. This is implemented this way so that you can easily separate the bot's diagnostics messages from Backtesting, Edge and Hyperopt results, output from other various Freqtrade utility sub-commands, as well as from the output of your custom `print()`'s you may have inserted into your strategy. So if you need to search the log messages with the grep utility, you need to redirect stderr to stdout and disregard stdout.
@@ -136,6 +195,8 @@ On Windows, the `--logfile` option is also supported by Freqtrade and you can us
> type \path\to\mylogfile.log | findstr "something"
```
## Hyperopt module
### Why does freqtrade not have GPU support?
First of all, most indicator libraries don't have GPU support - as such, there would be little benefit for indicator calculations.
@@ -144,35 +205,33 @@ The GPU improvements would only apply to pandas-native calculations - or ones wr
For hyperopt, freqtrade is using scikit-optimize, which is built on top of scikit-learn.
Their statement about GPU support is [pretty clear](https://scikit-learn.org/stable/faq.html#will-you-add-gpu-support).
GPU's also are only good at crunching numbers (floating point operations).
For hyperopt, we need both number-crunching (find next parameters) and running python code (running backtesting).
GPU's also are only good at crunching numbers (floating point operations).
For hyperopt, we need both number-crunching (find next parameters) and running python code (running backtesting).
As such, GPU's are not too well suited for most parts of hyperopt.
The benefit of using GPU would therefore be pretty slim - and will not justify the complexity introduced by trying to add GPU support.
There is however nothing preventing you from using GPU-enabled indicators within your strategy if you think you must have this - you will however probably be disappointed by the slim gain that will give you (compared to the complexity).
## Hyperopt module
### How many epochs do I need to get a good Hyperopt result?
Per default Hyperopt called without the `-e`/`--epochs` command line option will only
run 100 epochs, means 100 evaluations of your triggers, guards, ... Too few
to find a great result (unless if you are very lucky), so you probably
have to run it for 10.000 or more. But it will take an eternity to
have to run it for 10000 or more. But it will take an eternity to
compute.
Since hyperopt uses Bayesian search, running for too many epochs may not produce greater results.
It's therefore recommended to run between 500-1000 epochs over and over until you hit at least 10.000 epochs in total (or are satisfied with the result). You can best judge by looking at the results - if the bot keeps discovering better strategies, it's best to keep on going.
It's therefore recommended to run between 500-1000 epochs over and over until you hit at least 10000 epochs in total (or are satisfied with the result). You can best judge by looking at the results - if the bot keeps discovering better strategies, it's best to keep on going.
* Discovering a great strategy with Hyperopt takes time. Study www.freqtrade.io, the Freqtrade Documentation page, join the Freqtrade [Slack community](https://join.slack.com/t/highfrequencybot/shared_invite/zt-mm786y93-Fxo37glxMY9g8OQC5AoOIw) - or the Freqtrade [discord community](https://discord.gg/p7nuUNVfP7). While you patiently wait for the most advanced, free crypto bot in the world, to hand you a possible golden strategy specially designed just for you.
* Discovering a great strategy with Hyperopt takes time. Study www.freqtrade.io, the Freqtrade Documentation page, join the Freqtrade [discord community](https://discord.gg/p7nuUNVfP7). While you patiently wait for the most advanced, free crypto bot in the world, to hand you a possible golden strategy specially designed just for you.
* If you wonder why it can take from 20 minutes to days to do 1000 epochs here are some answers:
@@ -188,9 +247,9 @@ already 8\*10^9\*10 evaluations. A roughly total of 80 billion evaluations.
Did you run 100 000 evaluations? Congrats, you've done roughly 1 / 100 000 th
of the search space, assuming that the bot never tests the same parameters more than once.
* The time it takes to run 1000 hyperopt epochs depends on things like: The available cpu, hard-disk, ram, timeframe, timerange, indicator settings, indicator count, amount of coins that hyperopt test strategies on and the resulting trade count - which can be 650 trades in a year or 10.0000 trades depending if the strategy aims for big profits by trading rarely or for many low profit trades.
* The time it takes to run 1000 hyperopt epochs depends on things like: The available cpu, hard-disk, ram, timeframe, timerange, indicator settings, indicator count, amount of coins that hyperopt test strategies on and the resulting trade count - which can be 650 trades in a year or 100000 trades depending if the strategy aims for big profits by trading rarely or for many low profit trades.
Example: 4% profit 650 times vs 0,3% profit a trade 10.000 times in a year. If we assume you set the --timerange to 365 days.
Example: 4% profit 650 times vs 0,3% profit a trade 10000 times in a year. If we assume you set the --timerange to 365 days.
Nobody affiliated with the freqtrade project will ask you about your exchange keys or anything else exposing your funds to exploitation.
Should you be asked to expose your exchange keys or send funds to some random wallet, then please don't follow these instructions.
Failing to follow these guidelines will not be responsibility of freqtrade.
## "Freqtrade token"
Freqtrade does not have a Crypto token offering.
Token offerings you find on the internet referring Freqtrade, FreqAI or freqUI must be considered to be a scam, trying to exploit freqtrade's popularity for their own, nefarious gains.
FreqAI is configured through the typical [Freqtrade config file](configuration.md) and the standard [Freqtrade strategy](strategy-customization.md). Examples of FreqAI config and strategy files can be found in `config_examples/config_freqai.example.json` and `freqtrade/templates/FreqaiExampleStrategy.py`, respectively.
## Setting up the configuration file
Although there are plenty of additional parameters to choose from, as highlighted in the [parameter table](freqai-parameter-table.md#parameter-table), a FreqAI config must at minimum include the following parameters (the parameter values are only examples):
```json
"freqai":{
"enabled":true,
"purge_old_models":2,
"train_period_days":30,
"backtest_period_days":7,
"identifier":"unique-id",
"feature_parameters":{
"include_timeframes":["5m","15m","4h"],
"include_corr_pairlist":[
"ETH/USD",
"LINK/USD",
"BNB/USD"
],
"label_period_candles":24,
"include_shifted_candles":2,
"indicator_periods_candles":[10,20]
},
"data_split_parameters":{
"test_size":0.25
}
}
```
A full example config is available in `config_examples/config_freqai.example.json`.
## Building a FreqAI strategy
The FreqAI strategy requires including the following lines of code in the standard [Freqtrade strategy](strategy-customization.md):
```python
# user should define the maximum startup candle count (the largest number of candles
Notice how the `feature_engineering_*()` is where [features](freqai-feature-engineering.md#feature-engineering) are added. Meanwhile `set_freqai_targets()` adds the labels/targets. A full example strategy is available in `templates/FreqaiExampleStrategy.py`.
!!! Note
The `self.freqai.start()` function cannot be called outside the `populate_indicators()`.
!!! Note
Features **must** be defined in `feature_engineering_*()`. Defining FreqAI features in `populate_indicators()`
will cause the algorithm to fail in live/dry mode. In order to add generalized features that are not associated with a specific pair or timeframe, you should use `feature_engineering_standard()`
(as exemplified in `freqtrade/templates/FreqaiExampleStrategy.py`).
## Important dataframe key patterns
Below are the values you can expect to include/use inside a typical strategy dataframe (`df[]`):
| DataFrame Key | Description |
|------------|-------------|
| `df['&*']` | Any dataframe column prepended with `&` in `set_freqai_targets()` is treated as a training target (label) inside FreqAI (typically following the naming convention `&-s*`). For example, to predict the close price 40 candles into the future, you would set `df['&-s_close'] = df['close'].shift(-self.freqai_info["feature_parameters"]["label_period_candles"])` with `"label_period_candles": 40` in the config. FreqAI makes the predictions and gives them back under the same key (`df['&-s_close']`) to be used in `populate_entry/exit_trend()`. <br>**Datatype:** Depends on the output of the model.
| `df['&*_std/mean']` | Standard deviation and mean values of the defined labels during training (or live tracking with `fit_live_predictions_candles`). Commonly used to understand the rarity of a prediction (use the z-score as shown in `templates/FreqaiExampleStrategy.py` and explained [here](#creating-a-dynamic-target-threshold) to evaluate how often a particular prediction was observed during training or historically with `fit_live_predictions_candles`). <br>**Datatype:** Float.
| `df['do_predict']` | Indication of an outlier data point. The return value is integer between -2 and 2, which lets you know if the prediction is trustworthy or not. `do_predict==1` means that the prediction is trustworthy. If the Dissimilarity Index (DI, see details [here](freqai-feature-engineering.md#identifying-outliers-with-the-dissimilarity-index-di)) of the input data point is above the threshold defined in the config, FreqAI will subtract 1 from `do_predict`, resulting in `do_predict==0`. If `use_SVM_to_remove_outliers` is active, the Support Vector Machine (SVM, see details [here](freqai-feature-engineering.md#identifying-outliers-using-a-support-vector-machine-svm)) may also detect outliers in training and prediction data. In this case, the SVM will also subtract 1 from `do_predict`. If the input data point was considered an outlier by the SVM but not by the DI, or vice versa, the result will be `do_predict==0`. If both the DI and the SVM considers the input data point to be an outlier, the result will be `do_predict==-1`. As with the SVM, if `use_DBSCAN_to_remove_outliers` is active, DBSCAN (see details [here](freqai-feature-engineering.md#identifying-outliers-with-dbscan)) may also detect outliers and subtract 1 from `do_predict`. Hence, if both the SVM and DBSCAN are active and identify a datapoint that was above the DI threshold as an outlier, the result will be `do_predict==-2`. A particular case is when `do_predict == 2`, which means that the model has expired due to exceeding `expired_hours`. <br>**Datatype:** Integer between -2 and 2.
| `df['DI_values']` | Dissimilarity Index (DI) values are proxies for the level of confidence FreqAI has in the prediction. A lower DI means the prediction is close to the training data, i.e., higher prediction confidence. See details about the DI [here](freqai-feature-engineering.md#identifying-outliers-with-the-dissimilarity-index-di). <br>**Datatype:** Float.
| `df['%*']` | Any dataframe column prepended with `%` in `feature_engineering_*()` is treated as a training feature. For example, you can include the RSI in the training feature set (similar to in `templates/FreqaiExampleStrategy.py`) by setting `df['%-rsi']`. See more details on how this is done [here](freqai-feature-engineering.md). <br>**Note:** Since the number of features prepended with `%` can multiply very quickly (10s of thousands of features are easily engineered using the multiplictative functionality of, e.g., `include_shifted_candles` and `include_timeframes` as described in the [parameter table](freqai-parameter-table.md)), these features are removed from the dataframe that is returned from FreqAI to the strategy. To keep a particular type of feature for plotting purposes, you would prepend it with `%%`. <br>**Datatype:** Depends on the output of the model.
## Setting the `startup_candle_count`
The `startup_candle_count` in the FreqAI strategy needs to be set up in the same way as in the standard Freqtrade strategy (see details [here](strategy-customization.md#strategy-startup-period)). This value is used by Freqtrade to ensure that a sufficient amount of data is provided when calling the `dataprovider`, to avoid any NaNs at the beginning of the first training. You can easily set this value by identifying the longest period (in candle units) which is passed to the indicator creation functions (e.g., TA-Lib functions). In the presented example, `startup_candle_count` is 20 since this is the maximum value in `indicators_periods_candles`.
!!! Note
There are instances where the TA-Lib functions actually require more data than just the passed `period` or else the feature dataset gets populated with NaNs. Anecdotally, multiplying the `startup_candle_count` by 2 always leads to a fully NaN free training dataset. Hence, it is typically safest to multiply the expected `startup_candle_count` by 2. Look out for this log message to confirm that the data is clean:
```
2022-08-31 15:14:04 - freqtrade.freqai.data_kitchen - INFO - dropped 0 training points due to NaNs in populated dataset 4319.
```
## Creating a dynamic target threshold
Deciding when to enter or exit a trade can be done in a dynamic way to reflect current market conditions. FreqAI allows you to return additional information from the training of a model (more info [here](freqai-feature-engineering.md#returning-additional-info-from-training)). For example, the `&*_std/mean` return values describe the statistical distribution of the target/label *during the most recent training*. Comparing a given prediction to these values allows you to know the rarity of the prediction. In `templates/FreqaiExampleStrategy.py`, the `target_roi` and `sell_roi` are defined to be 1.25 z-scores away from the mean which causes predictions that are closer to the mean to be filtered out.
To consider the population of *historical predictions* for creating the dynamic target instead of information from the training as discussed above, you would set `fit_live_predictions_candles` in the config to the number of historical prediction candles you wish to use to generate target statistics.
```json
"freqai": {
"fit_live_predictions_candles": 300,
}
```
If this value is set, FreqAI will initially use the predictions from the training data and subsequently begin introducing real prediction data as it is generated. FreqAI will save this historical data to be reloaded if you stop and restart a model with the same `identifier`.
## Using different prediction models
FreqAI has multiple example prediction model libraries that are ready to be used as is via the flag `--freqaimodel`. These libraries include `CatBoost`, `LightGBM`, and `XGBoost` regression, classification, and multi-target models, and can be found in `freqai/prediction_models/`.
Regression and classification models differ in what targets they predict - a regression model will predict a target of continuous values, for example what price BTC will be at tomorrow, whilst a classifier will predict a target of discrete values, for example if the price of BTC will go up tomorrow or not. This means that you have to specify your targets differently depending on which model type you are using (see details [below](#setting-model-targets)).
All of the aforementioned model libraries implement gradient boosted decision tree algorithms. They all work on the principle of ensemble learning, where predictions from multiple simple learners are combined to get a final prediction that is more stable and generalized. The simple learners in this case are decision trees. Gradient boosting refers to the method of learning, where each simple learner is built in sequence - the subsequent learner is used to improve on the error from the previous learner. If you want to learn more about the different model libraries you can find the information in their respective docs:
There are also numerous online articles describing and comparing the algorithms. Some relatively lightweight examples would be [CatBoost vs. LightGBM vs. XGBoost — Which is the best algorithm?](https://towardsdatascience.com/catboost-vs-lightgbm-vs-xgboost-c80f40662924#:~:text=In%20CatBoost%2C%20symmetric%20trees%2C%20or,the%20same%20depth%20can%20differ.) and [XGBoost, LightGBM or CatBoost — which boosting algorithm should I use?](https://medium.com/riskified-technology/xgboost-lightgbm-or-catboost-which-boosting-algorithm-should-i-use-e7fda7bb36bc). Keep in mind that the performance of each model is highly dependent on the application and so any reported metrics might not be true for your particular use of the model.
Apart from the models already available in FreqAI, it is also possible to customize and create your own prediction models using the `IFreqaiModel` class. You are encouraged to inherit `fit()`, `train()`, and `predict()` to customize various aspects of the training procedures. You can place custom FreqAI models in `user_data/freqaimodels` - and freqtrade will pick them up from there based on the provided `--freqaimodel` name - which has to correspond to the class name of your custom model.
Make sure to use unique names to avoid overriding built-in models.
### Setting model targets
#### Regressors
If you are using a regressor, you need to specify a target that has continuous values. FreqAI includes a variety of regressors, such as the `CatboostRegressor`via the flag `--freqaimodel CatboostRegressor`. An example of how you could set a regression target for predicting the price 100 candles into the future would be
```python
df['&s-close_price'] = df['close'].shift(-100)
```
If you want to predict multiple targets, you need to define multiple labels using the same syntax as shown above.
#### Classifiers
If you are using a classifier, you need to specify a target that has discrete values. FreqAI includes a variety of classifiers, such as the `CatboostClassifier` via the flag `--freqaimodel CatboostClassifier`. If you elects to use a classifier, the classes need to be set using strings. For example, if you want to predict if the price 100 candles into the future goes up or down you would set
If you want to predict multiple targets you must specify all labels in the same label column. You could, for example, add the label `same` to define where the price was unchanged by setting
The PyTorch module requires large packages such as `torch`, which should be explicitly requested during `./setup.sh -i` by answering "y" to the question "Do you also want dependencies for freqai-rl or PyTorch (~700mb additional space required) [y/N]?".
Users who prefer docker should ensure they use the docker image appended with `_freqaitorch`.
We do provide an explicit docker-compose file for this in `docker/docker-compose-freqai.yml` - which can be used via `docker compose -f docker/docker-compose-freqai.yml run ...` - or can be copied to replace the original docker file.
This docker-compose file also contains a (disabled) section to enable GPU resources within docker containers. This obviously assumes the system has GPU resources available.
### Structure
#### Model
You can construct your own Neural Network architecture in PyTorch by simply defining your `nn.Module` class inside your custom [`IFreqaiModel` file](#using-different-prediction-models) and then using that class in your `def train()` function. Here is an example of logistic regression model implementation using PyTorch (should be used with nn.BCELoss criterion) for classification tasks.
The `PyTorchModelTrainer` performs the idiomatic PyTorch train loop:
Define our model, loss function, and optimizer, and then move them to the appropriate device (GPU or CPU). Inside the loop, we iterate through the batches in the dataloader, move the data to the device, compute the prediction and loss, backpropagate, and update the model parameters using the optimizer.
In addition, the trainer is responsible for the following:
- saving and loading the model
- converting the data from `pandas.DataFrame` to `torch.Tensor`.
#### Integration with Freqai module
Like all freqai models, PyTorch models inherit `IFreqaiModel`. `IFreqaiModel` declares three abstract methods: `train`, `fit`, and `predict`. we implement these methods in three levels of hierarchy.
From top to bottom:
1. `BasePyTorchModel` - Implements the `train` method. all `BasePyTorch*` inherit it. responsible for general data preparation (e.g., data normalization) and calling the `fit` method. Sets `device` attribute used by children classes. Sets `model_type` attribute used by the parent class.
2. `BasePyTorch*` - Implements the `predict` method. Here, the `*` represents a group of algorithms, such as classifiers or regressors. responsible for data preprocessing, predicting, and postprocessing if needed.
3. `PyTorch*Classifier` / `PyTorch*Regressor` - implements the `fit` method. responsible for the main train flaw, where we initialize the trainer and model objects.

#### Full example
Building a PyTorch regressor using MLP (multilayer perceptron) model, MSELoss criterion, and AdamW optimizer.
Here we create a `PyTorchMLPRegressor` class that implements the `fit` method. The `fit` method specifies the training building blocks: model, optimizer, criterion, and trainer. We inherit both `BasePyTorchRegressor` and `BasePyTorchModel`, where the former implements the `predict` method that is suitable for our regression task, and the latter implements the train method.
??? Note "Setting Class Names for Classifiers"
When using classifiers, the user must declare the class names (or targets) by overriding the `IFreqaiModel.class_names` attribute. This is achieved by setting `self.freqai.class_names` in the FreqAI strategy inside the `set_freqai_targets` method.
For example, if you are using a binary classifier to predict price movements as up or down, you can set the class names as follows:
To see a full example, you can refer to the [classifier test strategy class](https://github.com/freqtrade/freqtrade/blob/develop/tests/strategy/strats/freqai_test_classifier.py).
#### Improving performance with `torch.compile()`
Torch provides a `torch.compile()` method that can be used to improve performance for specific GPU hardware. More details can be found [here](https://pytorch.org/tutorials/intermediate/torch_compile_tutorial.html). In brief, you simply wrap your `model` in `torch.compile()`:
```python
model = PyTorchMLPModel(
input_dim=n_features,
output_dim=1,
**self.model_kwargs
)
model.to(self.device)
model = torch.compile(model)
```
Then proceed to use the model as normal. Keep in mind that doing this will remove eager execution, which means errors and tracebacks will not be informative.
The architecture and functions of FreqAI are generalized to encourages development of unique features, functions, models, etc.
The class structure and a detailed algorithmic overview is depicted in the following diagram:

As shown, there are three distinct objects comprising FreqAI:
* **IFreqaiModel** - A singular persistent object containing all the necessary logic to collect, store, and process data, engineer features, run training, and inference models.
* **FreqaiDataKitchen** - A non-persistent object which is created uniquely for each unique asset/model. Beyond metadata, it also contains a variety of data processing tools.
* **FreqaiDataDrawer** - A singular persistent object containing all the historical predictions, models, and save/load methods.
There are a variety of built-in [prediction models](freqai-configuration.md#using-different-prediction-models) which inherit directly from `IFreqaiModel`. Each of these models have full access to all methods in `IFreqaiModel` and can therefore override any of those functions at will. However, advanced users will likely stick to overriding `fit()`, `train()`, `predict()`, and `data_cleaning_train/predict()`.
## Data handling
FreqAI aims to organize model files, prediction data, and meta data in a way that simplifies post-processing and enhances crash resilience by automatic data reloading. The data is saved in a file structure,`user_data_dir/models/`, which contains all the data associated with the trainings and backtests. The `FreqaiDataKitchen()` relies heavily on the file structure for proper training and inferencing and should therefore not be manually modified.
### File structure
The file structure is automatically generated based on the model `identifier` set in the [config](freqai-configuration.md#setting-up-the-configuration-file). The following structure shows where the data is stored for post processing:
| Structure | Description |
|-----------|-------------|
| `config_*.json` | A copy of the model specific configuration file. |
| `historic_predictions.pkl` | A file containing all historic predictions generated during the lifetime of the `identifier` model during live deployment. `historic_predictions.pkl` is used to reload the model after a crash or a config change. A backup file is always held in case of corruption on the main file. FreqAI **automatically** detects corruption and replaces the corrupted file with the backup. |
| `pair_dictionary.json` | A file containing the training queue as well as the on disk location of the most recently trained model. |
| `sub-train-*_TIMESTAMP` | A folder containing all the files associated with a single model, such as: <br>
|| `*_metadata.json` - Metadata for the model, such as normalization max/min, expected training feature list, etc. <br>
|| `*_model.*` - The model file saved to disk for reloading from a crash. Can be `joblib` (typical boosting libs), `zip` (stable_baselines), `hd5` (keras type), etc. <br>
|| `*_pca_object.pkl` - The [Principal component analysis (PCA)](freqai-feature-engineering.md#data-dimensionality-reduction-with-principal-component-analysis) transform (if `principal_component_analysis: True` is set in the config) which will be used to transform unseen prediction features. <br>
|| `*_svm_model.pkl` - The [Support Vector Machine (SVM)](freqai-feature-engineering.md#identifying-outliers-using-a-support-vector-machine-svm) model (if `use_SVM_to_remove_outliers: True` is set in the config) which is used to detect outliers in unseen prediction features. <br>
|| `*_trained_df.pkl` - The dataframe containing all the training features used to train the `identifier` model. This is used for computing the [Dissimilarity Index (DI)](freqai-feature-engineering.md#identifying-outliers-with-the-dissimilarity-index-di) and can also be used for post-processing. <br>
|| `*_trained_dates.df.pkl` - The dates associated with the `trained_df.pkl`, which is useful for post-processing. |
Low level feature engineering is performed in the user strategy within a set of functions called `feature_engineering_*`. These function set the `base features` such as, `RSI`, `MFI`, `EMA`, `SMA`, time of day, volume, etc. The `base features` can be custom indicators or they can be imported from any technical-analysis library that you can find. FreqAI is equipped with a set of functions to simplify rapid large-scale feature engineering:
| Function | Description |
|---------------|-------------|
| `feature_engineering_expand_all()` | This optional function will automatically expand the defined features on the config defined `indicator_periods_candles`, `include_timeframes`, `include_shifted_candles`, and `include_corr_pairs`.
| `feature_engineering_expand_basic()` | This optional function will automatically expand the defined features on the config defined `include_timeframes`, `include_shifted_candles`, and `include_corr_pairs`. Note: this function does *not* expand across `include_periods_candles`.
| `feature_engineering_standard()` | This optional function will be called once with the dataframe of the base timeframe. This is the final function to be called, which means that the dataframe entering this function will contain all the features and columns from the base asset created by the other `feature_engineering_expand` functions. This function is a good place to do custom exotic feature extractions (e.g. tsfresh). This function is also a good place for any feature that should not be auto-expanded upon (e.g., day of the week).
| `set_freqai_targets()` | Required function to set the targets for the model. All targets must be prepended with `&` to be recognized by the FreqAI internals.
Meanwhile, high level feature engineering is handled within `"feature_parameters":{}` in the FreqAI config. Within this file, it is possible to decide large scale feature expansions on top of the `base_features` such as "including correlated pairs" or "including informative timeframes" or even "including recent candles."
It is advisable to start from the template `feature_engineering_*` functions in the source provided example strategy (found in `templates/FreqaiExampleStrategy.py`) to ensure that the feature definitions are following the correct conventions. Here is an example of how to set the indicators and labels in the strategy:
In the presented example, the user does not wish to pass the `bb_lowerband` as a feature to the model,
and has therefore not prepended it with `%`. The user does, however, wish to pass `bb_width` to the
model for training/prediction and has therefore prepended it with `%`.
After having defined the `base features`, the next step is to expand upon them using the powerful `feature_parameters` in the configuration file:
```json
"freqai":{
//...
"feature_parameters":{
"include_timeframes":["5m","15m","4h"],
"include_corr_pairlist":[
"ETH/USD",
"LINK/USD",
"BNB/USD"
],
"label_period_candles":24,
"include_shifted_candles":2,
"indicator_periods_candles":[10,20]
},
//...
}
```
The `include_timeframes` in the config above are the timeframes (`tf`) of each call to `feature_engineering_expand_*()` in the strategy. In the presented case, the user is asking for the `5m`, `15m`, and `4h` timeframes of the `rsi`, `mfi`, `roc`, and `bb_width` to be included in the feature set.
You can ask for each of the defined features to be included also for informative pairs using the `include_corr_pairlist`. This means that the feature set will include all the features from `feature_engineering_expand_*()` on all the `include_timeframes` for each of the correlated pairs defined in the config (`ETH/USD`, `LINK/USD`, and `BNB/USD` in the presented example).
`include_shifted_candles` indicates the number of previous candles to include in the feature set. For example, `include_shifted_candles: 2` tells FreqAI to include the past 2 candles for each of the features in the feature set.
In total, the number of features the user of the presented example strat has created is: length of `include_timeframes`* no. features in `feature_engineering_expand_*()` * length of `include_corr_pairlist` * no. `include_shifted_candles` * length of `indicator_periods_candles`
$= 3 * 3 * 3 * 2 * 2 = 108$.
!!! note "Learn more about creative feature engineering"
Check out our [medium article](https://emergentmethods.medium.com/freqai-from-price-to-prediction-6fadac18b665) geared toward helping users learn how to creatively engineer features.
### Gain finer control over `feature_engineering_*` functions with `metadata`
All `feature_engineering_*` and `set_freqai_targets()` functions are passed a `metadata` dictionary which contains information about the `pair`, `tf` (timeframe), and `period` that FreqAI is automating for feature building. As such, a user can use `metadata` inside `feature_engineering_*` functions as criteria for blocking/reserving features for certain timeframes, periods, pairs etc.
This will block `ta.ROC()` from being added to any timeframes other than `"1h"`.
### Returning additional info from training
Important metrics can be returned to the strategy at the end of each model training by assigning them to `dk.data['extra_returns_per_train']['my_new_value'] = XYZ` inside the custom prediction model class.
FreqAI takes the `my_new_value` assigned in this dictionary and expands it to fit the dataframe that is returned to the strategy. You can then use the returned metrics in your strategy through `dataframe['my_new_value']`. An example of how return values can be used in FreqAI are the `&*_mean` and `&*_std` values that are used to [created a dynamic target threshold](freqai-configuration.md#creating-a-dynamic-target-threshold).
Another example, where the user wants to use live metrics from the trade database, is shown below:
```json
"freqai": {
"extra_returns_per_train": {"total_profit": 4}
}
```
You need to set the standard dictionary in the config so that FreqAI can return proper dataframe shapes. These values will likely be overridden by the prediction model, but in the case where the model has yet to set them, or needs a default initial value, the pre-set values are what will be returned.
### Weighting features for temporal importance
FreqAI allows you to set a `weight_factor` to weight recent data more strongly than past data via an exponential function:
$$ W_i = \exp(\frac{-i}{\alpha*n}) $$
where $W_i$ is the weight of data point $i$ in a total set of $n$ data points. Below is a figure showing the effect of different weight factors on the data points in a feature set.

## Building the data pipeline
By default, FreqAI builds a dynamic pipeline based on user congfiguration settings. The default settings are robust and designed to work with a variety of methods. These two steps are a `MinMaxScaler(-1,1)` and a `VarianceThreshold` which removes any column that has 0 variance. Users can activate other steps with more configuration parameters. For example if users add `use_SVM_to_remove_outliers: true` to the `freqai` config, then FreqAI will automatically add the [`SVMOutlierExtractor`](#identifying-outliers-using-a-support-vector-machine-svm) to the pipeline. Likewise, users can add `principal_component_analysis: true` to the `freqai` config to activate PCA. The [DissimilarityIndex](#identifying-outliers-with-the-dissimilarity-index-di) is activated with `DI_threshold: 1`. Finally, noise can also be added to the data with `noise_standard_deviation: 0.1`. Finally, users can add [DBSCAN](#identifying-outliers-with-dbscan) outlier removal with `use_DBSCAN_to_remove_outliers: true`.
!!! note "More information available"
Please review the [parameter table](freqai-parameter-table.md) for more information on these parameters.
### Customizing the pipeline
Users are encouraged to customize the data pipeline to their needs by building their own data pipeline. This can be done by simply setting `dk.feature_pipeline` to their desired `Pipeline` object inside their `IFreqaiModel` `train()` function, or if they prefer not to touch the `train()` function, they can override `define_data_pipeline`/`define_label_pipeline` functions in their `IFreqaiModel`:
!!! note "More information available"
FreqAI uses the the [`DataSieve`](https://github.com/emergentmethods/datasieve) pipeline, which follows the SKlearn pipeline API, but adds, among other features, coherence between the X, y, and sample_weight vector point removals, feature removal, feature name following.
```python
from datasieve.transforms import SKLearnWrapper, DissimilarityIndex
from datasieve.pipeline import Pipeline
from sklearn.preprocessing import QuantileTransformer, StandardScaler
from freqai.base_models import BaseRegressionModel
User defines their custom label pipeline here (if they wish)
"""
label_pipeline = Pipeline([
('qt', SKLearnWrapper(StandardScaler())),
])
return label_pipeline
```
Here, you are defining the exact pipeline that will be used for your feature set during training and prediction. You can use *most* SKLearn transformation steps by wrapping them in the `SKLearnWrapper` class as shown above. In addition, you can use any of the transformations available in the [`DataSieve` library](https://github.com/emergentmethods/datasieve).
You can easily add your own transformation by creating a class that inherits from the datasieve `BaseTransform` and implementing your `fit()`, `transform()` and `inverse_transform()` methods:
```python
from datasieve.transforms.base_transform import BaseTransform
# do/dont do something with X, y, sample_weight, or/and feature_list
return X, y, sample_weight, feature_list
```
!!! note "Hint"
You can define this custom class in the same file as your `IFreqaiModel`.
### Migrating a custom `IFreqaiModel` to the new Pipeline
If you have created your own custom `IFreqaiModel` with a custom `train()`/`predict()` function, *and* you still rely on `data_cleaning_train/predict()`, then you will need to migrate to the new pipeline. If your model does *not* rely on `data_cleaning_train/predict()`, then you do not need to worry about this migration.
More details about the migration can be found [here](strategy_migration.md#freqai---new-data-pipeline).
## Outlier detection
Equity and crypto markets suffer from a high level of non-patterned noise in the form of outlier data points. FreqAI implements a variety of methods to identify such outliers and hence mitigate risk.
### Identifying outliers with the Dissimilarity Index (DI)
The Dissimilarity Index (DI) aims to quantify the uncertainty associated with each prediction made by the model.
You can tell FreqAI to remove outlier data points from the training/test data sets using the DI by including the following statement in the config:
```json
"freqai": {
"feature_parameters" : {
"DI_threshold": 1
}
}
```
Which will add `DissimilarityIndex` step to your `feature_pipeline` and set the threshold to 1. The DI allows predictions which are outliers (not existent in the model feature space) to be thrown out due to low levels of certainty. To do so, FreqAI measures the distance between each training data point (feature vector), $X_{a}$, and all other training data points:
where $d_{ab}$ is the distance between the normalized points $a$ and $b$, and $p$ is the number of features, i.e., the length of the vector $X$. The characteristic distance, $\overline{d}$, for a set of training data points is simply the mean of the average distances:
$\overline{d}$ quantifies the spread of the training data, which is compared to the distance between a new prediction feature vectors, $X_k$ and all the training data:
$$ d_k = \arg \min d_{k,i} $$
This enables the estimation of the Dissimilarity Index as:
$$ DI_k = d_k/\overline{d} $$
You can tweak the DI through the `DI_threshold` to increase or decrease the extrapolation of the trained model. A higher `DI_threshold` means that the DI is more lenient and allows predictions further away from the training data to be used whilst a lower `DI_threshold` has the opposite effect and hence discards more predictions.
Below is a figure that describes the DI for a 3D data set.

### Identifying outliers using a Support Vector Machine (SVM)
You can tell FreqAI to remove outlier data points from the training/test data sets using a Support Vector Machine (SVM) by including the following statement in the config:
```json
"freqai": {
"feature_parameters" : {
"use_SVM_to_remove_outliers": true
}
}
```
Which will add `SVMOutlierExtractor` step to your `feature_pipeline`. The SVM will be trained on the training data and any data point that the SVM deems to be beyond the feature space will be removed.
You can elect to provide additional parameters for the SVM, such as `shuffle`, and `nu` via the `feature_parameters.svm_params` dictionary in the config.
The parameter `shuffle` is by default set to `False` to ensure consistent results. If it is set to `True`, running the SVM multiple times on the same data set might result in different outcomes due to `max_iter` being to low for the algorithm to reach the demanded `tol`. Increasing `max_iter` solves this issue but causes the procedure to take longer time.
The parameter `nu`, *very* broadly, is the amount of data points that should be considered outliers and should be between 0 and 1.
### Identifying outliers with DBSCAN
You can configure FreqAI to use DBSCAN to cluster and remove outliers from the training/test data set or incoming outliers from predictions, by activating `use_DBSCAN_to_remove_outliers` in the config:
```json
"freqai": {
"feature_parameters" : {
"use_DBSCAN_to_remove_outliers": true
}
}
```
Which will add the `DataSieveDBSCAN` step to your `feature_pipeline`. This is an unsupervised machine learning algorithm that clusters data without needing to know how many clusters there should be.
Given a number of data points $N$, and a distance $\varepsilon$, DBSCAN clusters the data set by setting all data points that have $N-1$ other data points within a distance of $\varepsilon$ as *core points*. A data point that is within a distance of $\varepsilon$ from a *core point* but that does not have $N-1$ other data points within a distance of $\varepsilon$ from itself is considered an *edge point*. A cluster is then the collection of *core points* and *edge points*. Data points that have no other data points at a distance $<\varepsilon$ are considered outliers. The figure below shows a cluster with $N = 3$.

FreqAI uses `sklearn.cluster.DBSCAN` (details are available on scikit-learn's webpage [here](https://scikit-learn.org/stable/modules/generated/sklearn.cluster.DBSCAN.html) (external website)) with `min_samples` ($N$) taken as 1/4 of the no. of time points (candles) in the feature set. `eps` ($\varepsilon$) is computed automatically as the elbow point in the *k-distance graph* computed from the nearest neighbors in the pairwise distances of all data points in the feature set.
The table below will list all configuration parameters available for FreqAI. Some of the parameters are exemplified in `config_examples/config_freqai.example.json`.
Mandatory parameters are marked as **Required** and have to be set in one of the suggested ways.
### General configuration parameters
| Parameter | Description |
|------------|-------------|
| | **General configuration parameters within the `config.freqai` tree**
| `freqai` | **Required.**<br> The parent dictionary containing all the parameters for controlling FreqAI. <br>**Datatype:** Dictionary.
| `train_period_days` | **Required.**<br> Number of days to use for the training data (width of the sliding window). <br>**Datatype:** Positive integer.
| `backtest_period_days` | **Required.**<br> Number of days to inference from the trained model before sliding the `train_period_days` window defined above, and retraining the model during backtesting (more info [here](freqai-running.md#backtesting)). This can be fractional days, but beware that the provided `timerange` will be divided by this number to yield the number of trainings necessary to complete the backtest. <br>**Datatype:** Float.
| `identifier` | **Required.**<br> A unique ID for the current model. If models are saved to disk, the `identifier` allows for reloading specific pre-trained models/data. <br>**Datatype:** String.
| `live_retrain_hours` | Frequency of retraining during dry/live runs. <br>**Datatype:** Float > 0. <br> Default: `0` (models retrain as often as possible).
| `expiration_hours` | Avoid making predictions if a model is more than `expiration_hours` old. <br>**Datatype:** Positive integer. <br> Default: `0` (models never expire).
| `purge_old_models` | Number of models to keep on disk (not relevant to backtesting). Default is 2, which means that dry/live runs will keep the latest 2 models on disk. Setting to 0 keeps all models. This parameter also accepts a boolean to maintain backwards compatibility. <br>**Datatype:** Integer. <br> Default: `2`.
| `save_backtest_models` | Save models to disk when running backtesting. Backtesting operates most efficiently by saving the prediction data and reusing them directly for subsequent runs (when you wish to tune entry/exit parameters). Saving backtesting models to disk also allows to use the same model files for starting a dry/live instance with the same model `identifier`. <br>**Datatype:** Boolean. <br> Default: `False` (no models are saved).
| `fit_live_predictions_candles` | Number of historical candles to use for computing target (label) statistics from prediction data, instead of from the training dataset (more information can be found [here](freqai-configuration.md#creating-a-dynamic-target-threshold)). <br>**Datatype:** Positive integer.
| `continual_learning` | Use the final state of the most recently trained model as starting point for the new model, allowing for incremental learning (more information can be found [here](freqai-running.md#continual-learning)). Beware that this is currently a naive approach to incremental learning, and it has a high probability of overfitting/getting stuck in local minima while the market moves away from your model. We have the connections here primarily for experimental purposes and so that it is ready for more mature approaches to continual learning in chaotic systems like the crypto market. <br>**Datatype:** Boolean. <br> Default: `False`.
| `write_metrics_to_disk` | Collect train timings, inference timings and cpu usage in json file. <br>**Datatype:** Boolean. <br> Default: `False`
| `data_kitchen_thread_count` | <br> Designate the number of threads you want to use for data processing (outlier methods, normalization, etc.). This has no impact on the number of threads used for training. If user does not set it (default), FreqAI will use max number of threads - 2 (leaving 1 physical core available for Freqtrade bot and FreqUI) <br>**Datatype:** Positive integer.
| `activate_tensorboard` | <br> Indicate whether or not to activate tensorboard for the tensorboard enabled modules (currently Reinforcment Learning, XGBoost, Catboost, and PyTorch). Tensorboard needs Torch installed, which means you will need the torch/RL docker image or you need to answer "yes" to the install question about whether or not you wish to install Torch. <br>**Datatype:** Boolean. <br> Default: `True`.
### Feature parameters
| Parameter | Description |
|------------|-------------|
| | **Feature parameters within the `freqai.feature_parameters` sub dictionary**
| `feature_parameters` | A dictionary containing the parameters used to engineer the feature set. Details and examples are shown [here](freqai-feature-engineering.md). <br>**Datatype:** Dictionary.
| `include_timeframes` | A list of timeframes that all indicators in `feature_engineering_expand_*()` will be created for. The list is added as features to the base indicators dataset. <br>**Datatype:** List of timeframes (strings).
| `include_corr_pairlist` | A list of correlated coins that FreqAI will add as additional features to all `pair_whitelist` coins. All indicators set in `feature_engineering_expand_*()` during feature engineering (see details [here](freqai-feature-engineering.md)) will be created for each correlated coin. The correlated coins features are added to the base indicators dataset. <br>**Datatype:** List of assets (strings).
| `label_period_candles` | Number of candles into the future that the labels are created for. This is used in `feature_engineering_expand_all()` (see `templates/FreqaiExampleStrategy.py` for detailed usage). You can create custom labels and choose whether to make use of this parameter or not. <br>**Datatype:** Positive integer.
| `include_shifted_candles` | Add features from previous candles to subsequent candles with the intent of adding historical information. If used, FreqAI will duplicate and shift all features from the `include_shifted_candles` previous candles so that the information is available for the subsequent candle. <br>**Datatype:** Positive integer.
| `weight_factor` | Weight training data points according to their recency (see details [here](freqai-feature-engineering.md#weighting-features-for-temporal-importance)). <br>**Datatype:** Positive float (typically <1).
|`indicator_max_period_candles`|**No longer used (#7325)**.Replacedby`startup_candle_count`whichissetinthe [strategy](freqai-configuration.md#building-a-freqai-strategy).`startup_candle_count`istimeframeindependentanddefinesthemaximum*period*usedin`feature_engineering_*()`forindicatorcreation.FreqAIusesthisparametertogetherwiththemaximumtimeframein`include_time_frames`tocalculatehowmanydatapointstodownloadsuchthatthefirstdatapointdoesnotincludeaNaN.<br>**Datatype:** Positive integer.
| `indicator_periods_candles` | Time periods to calculate indicators for. The indicators are added to the base indicator dataset. <br>**Datatype:** List of positive integers.
| `principal_component_analysis` | Automatically reduce the dimensionality of the data set using Principal Component Analysis. See details about how it works [here](#reducing-data-dimensionality-with-principal-component-analysis) <br>**Datatype:** Boolean. <br> Default: `False`.
| `plot_feature_importances` | Create a feature importance plot for each model for the top/bottom `plot_feature_importances` number of features. Plot is stored in `user_data/models/<identifier>/sub-train-<COIN>_<timestamp>.html`. <br>**Datatype:** Integer. <br> Default: `0`.
| `DI_threshold` | Activates the use of the Dissimilarity Index for outlier detection when set to > 0. See details about how it works [here](freqai-feature-engineering.md#identifying-outliers-with-the-dissimilarity-index-di). <br>**Datatype:** Positive float (typically <1).
| `svm_params` | All parameters available in Sklearn's `SGDOneClassSVM()`. See details about some select parameters [here](freqai-feature-engineering.md#identifying-outliers-using-a-support-vector-machine-svm). <br>**Datatype:** Dictionary.
| `use_DBSCAN_to_remove_outliers` | Cluster data using the DBSCAN algorithm to identify and remove outliers from training and prediction data. See details about how it works [here](freqai-feature-engineering.md#identifying-outliers-with-dbscan). <br>**Datatype:** Boolean.
| `noise_standard_deviation` | If set, FreqAI adds noise to the training features with the aim of preventing overfitting. FreqAI generates random deviates from a gaussian distribution with a standard deviation of `noise_standard_deviation` and adds them to all data points. `noise_standard_deviation` should be kept relative to the normalized space, i.e., between -1 and 1. In other words, since data in FreqAI is always normalized to be between -1 and 1, `noise_standard_deviation: 0.05` would result in 32% of the data being randomly increased/decreased by more than 2.5% (i.e., the percent of data falling within the first standard deviation). <br>**Datatype:** Integer. <br> Default: `0`.
| `outlier_protection_percentage` | Enable to prevent outlier detection methods from discarding too much data. If more than `outlier_protection_percentage` % of points are detected as outliers by the SVM or DBSCAN, FreqAI will log a warning message and ignore outlier detection, i.e., the original dataset will be kept intact. If the outlier protection is triggered, no predictions will be made based on the training dataset. <br>**Datatype:** Float. <br> Default: `30`.
| `reverse_train_test_order` | Split the feature dataset (see below) and use the latest data split for training and test on historical split of the data. This allows the model to be trained up to the most recent data point, while avoiding overfitting. However, you should be careful to understand the unorthodox nature of this parameter before employing it. <br>**Datatype:** Boolean. <br> Default: `False` (no reversal).
| `shuffle_after_split` | Split the data into train and test sets, and then shuffle both sets individually. <br>**Datatype:** Boolean. <br> Default: `False`.
| `buffer_train_data_candles` | Cut `buffer_train_data_candles` off the beginning and end of the training data *after* the indicators were populated. The main example use is when predicting maxima and minima, the argrelextrema function cannot know the maxima/minima at the edges of the timerange. To improve model accuracy, it is best to compute argrelextrema on the full timerange and then use this function to cut off the edges (buffer) by the kernel. In another case, if the targets are set to a shifted price movement, this buffer is unnecessary because the shifted candles at the end of the timerange will be NaN and FreqAI will automatically cut those off of the training dataset.<br>**Datatype:** Integer. <br> Default: `0`.
### Data split parameters
| Parameter | Description |
|------------|-------------|
| | **Data split parameters within the `freqai.data_split_parameters` sub dictionary**
| `data_split_parameters` | Include any additional parameters available from scikit-learn `test_train_split()`, which are shown [here](https://scikit-learn.org/stable/modules/generated/sklearn.model_selection.train_test_split.html) (external website). <br>**Datatype:** Dictionary.
| `test_size` | The fraction of data that should be used for testing instead of training. <br>**Datatype:** Positive float <1.
| | **Model training parameters within the `freqai.model_training_parameters` sub dictionary**
| `model_training_parameters` | A flexible dictionary that includes all parameters available by the selected model library. For example, if you use `LightGBMRegressor`, this dictionary can contain any parameter available by the `LightGBMRegressor` [here](https://lightgbm.readthedocs.io/en/latest/pythonapi/lightgbm.LGBMRegressor.html) (external website). If you select a different model, this dictionary can contain any parameter from that model. A list of the currently available models can be found [here](freqai-configuration.md#using-different-prediction-models). <br>**Datatype:** Dictionary.
| `n_estimators` | The number of boosted trees to fit in the training of the model. <br>**Datatype:** Integer.
| `learning_rate` | Boosting learning rate during training of the model. <br>**Datatype:** Float.
| `n_jobs`, `thread_count`, `task_type` | Set the number of threads for parallel processing and the `task_type` (`gpu` or `cpu`). Different model libraries use different parameter names. <br>**Datatype:** Float.
### Reinforcement Learning parameters
| Parameter | Description |
|------------|-------------|
| | **Reinforcement Learning Parameters within the `freqai.rl_config` sub dictionary**
| `rl_config` | A dictionary containing the control parameters for a Reinforcement Learning model. <br>**Datatype:** Dictionary.
| `train_cycles` | Training time steps will be set based on the `train_cycles * number of training data points. <br> **Datatype:** Integer.
| `cpu_count` | Number of processors to dedicate to the Reinforcement Learning training process. <br> **Datatype:** int.
| `max_trade_duration_candles`| Guides the agent training to keep trades below desired length. Example usage shown in `prediction_models/ReinforcementLearner.py` within the customizable `calculate_reward()` function. <br> **Datatype:** int.
| `model_type` | Model string from stable_baselines3 or SBcontrib. Available strings include: `'TRPO', 'ARS', 'RecurrentPPO', 'MaskablePPO', 'PPO', 'A2C', 'DQN'`. User should ensure that `model_training_parameters` match those available to the corresponding stable_baselines3 model by visiting their documentaiton. [PPO doc](https://stable-baselines3.readthedocs.io/en/master/modules/ppo.html) (external website) <br> **Datatype:** string.
| `policy_type` | One of the available policy types from stable_baselines3 <br> **Datatype:** string.
| `max_training_drawdown_pct` | The maximum drawdown that the agent is allowed to experience during training. <br> **Datatype:** float. <br> Default: 0.8
| `cpu_count` | Number of threads/cpus to dedicate to the Reinforcement Learning training process (depending on if `ReinforcementLearning_multiproc` is selected or not). Recommended to leave this untouched, by default, this value is set to the total number of physical cores minus 1. <br> **Datatype:** int.
| `model_reward_parameters` | Parameters used inside the customizable `calculate_reward()` function in `ReinforcementLearner.py` <br> **Datatype:** int.
| `add_state_info` | Tell FreqAI to include state information in the feature set for training and inferencing. The current state variables include trade duration, current profit, trade position. This is only available in dry/live runs, and is automatically switched to false for backtesting. <br> **Datatype:** bool. <br> Default: `False`.
| `net_arch` | Network architecture which is well described in [`stable_baselines3` doc](https://stable-baselines3.readthedocs.io/en/master/guide/custom_policy.html#examples). In summary: `[<sharedlayers>, dict(vf=[<non-sharedvaluenetworklayers>], pi=[<non-sharedpolicynetworklayers>])]`. By default this is set to `[128, 128]`, which defines 2 shared hidden layers with 128 units each.
| `randomize_starting_position` | Randomize the starting point of each episode to avoid overfitting. <br> **Datatype:** bool. <br> Default: `False`.
| `drop_ohlc_from_features` | Do not include the normalized ohlc data in the feature set passed to the agent during training (ohlc will still be used for driving the environment in all cases) <br> **Datatype:** Boolean. <br> **Default:** `False`
| `progress_bar` | Display a progress bar with the current progress, elapsed time and estimated remaining time. <br> **Datatype:** Boolean. <br> Default: `False`.
### PyTorch parameters
#### general
| Parameter | Description |
|------------|-------------|
| | **Model training parameters within the `freqai.model_training_parameters` sub dictionary**
| `learning_rate` | Learning rate to be passed to the optimizer. <br> **Datatype:** float. <br> Default: `3e-4`.
| `model_kwargs` | Parameters to be passed to the model class. <br> **Datatype:** dict. <br> Default: `{}`.
| `trainer_kwargs` | Parameters to be passed to the trainer class. <br> **Datatype:** dict. <br> Default: `{}`.
#### trainer_kwargs
| Parameter | Description |
|--------------|-------------|
| | **Model training parameters within the `freqai.model_training_parameters.model_kwargs` sub dictionary**
| `n_epochs` | The `n_epochs` parameter is a crucial setting in the PyTorch training loop that determines the number of times the entire training dataset will be used to update the model's parameters. An epoch represents one full pass through the entire training dataset. Overrides `n_steps`. Either `n_epochs` or `n_steps` must be set. <br><br> **Datatype:** int. optional. <br> Default: `10`.
| `n_steps` | An alternative way of setting `n_epochs` - the number of training iterations to run. Iteration here refer to the number of times we call `optimizer.step()`. Ignored if `n_epochs` is set. A simplified version of the function: <br><br> n_epochs = n_steps / (n_obs / batch_size) <br><br> The motivation here is that `n_steps` is easier to optimize and keep stable across different n_obs - the number of data points. <br> <br> **Datatype:** int. optional. <br> Default: `None`.
| `batch_size` | The size of the batches to use during training. <br><br> **Datatype:** int. <br> Default: `64`.
### Additional parameters
| Parameter | Description |
|------------|-------------|
| | **Extraneous parameters**
| `freqai.keras` | If the selected model makes use of Keras (typical for TensorFlow-based prediction models), this flag needs to be activated so that the model save/loading follows Keras standards. <br> **Datatype:** Boolean. <br> Default: `False`.
| `freqai.conv_width` | The width of a neural network input tensor. This replaces the need for shifting candles (`include_shifted_candles`) by feeding in historical data points as the second dimension of the tensor. Technically, this parameter can also be used for regressors, but it only adds computational overhead and does not change the model training/prediction. <br> **Datatype:** Integer. <br> Default: `2`.
| `freqai.reduce_df_footprint` | Recast all numeric columns to float32/int32, with the objective of reducing ram/disk usage and decreasing train/inference timing. This parameter is set in the main level of the Freqtrade configuration file (not inside FreqAI). <br> **Datatype:** Boolean. <br> Default: `False`.
Reinforcement learning dependencies include large packages such as `torch`, which should be explicitly requested during `./setup.sh -i` by answering "y" to the question "Do you also want dependencies for freqai-rl (~700mb additional space required) [y/N]?".
Users who prefer docker should ensure they use the docker image appended with `_freqairl`.
## Background and terminology
### What is RL and why does FreqAI need it?
Reinforcement learning involves two important components, the *agent* and the training *environment*. During agent training, the agent moves through historical data candle by candle, always making 1 of a set of actions: Long entry, long exit, short entry, short exit, neutral). During this training process, the environment tracks the performance of these actions and rewards the agent according to a custom user made `calculate_reward()` (here we offer a default reward for users to build on if they wish [details here](#creating-a-custom-reward-function)). The reward is used to train weights in a neural network.
A second important component of the FreqAI RL implementation is the use of *state* information. State information is fed into the network at each step, including current profit, current position, and current trade duration. These are used to train the agent in the training environment, and to reinforce the agent in dry/live (this functionality is not available in backtesting). *FreqAI + Freqtrade is a perfect match for this reinforcing mechanism since this information is readily available in live deployments.*
Reinforcement learning is a natural progression for FreqAI, since it adds a new layer of adaptivity and market reactivity that Classifiers and Regressors cannot match. However, Classifiers and Regressors have strengths that RL does not have such as robust predictions. Improperly trained RL agents may find "cheats" and "tricks" to maximize reward without actually winning any trades. For this reason, RL is more complex and demands a higher level of understanding than typical Classifiers and Regressors.
### The RL interface
With the current framework, we aim to expose the training environment via the common "prediction model" file, which is a user inherited `BaseReinforcementLearner` object (e.g. `freqai/prediction_models/ReinforcementLearner`). Inside this user class, the RL environment is available and customized via `MyRLEnv` as [shown below](#creating-a-custom-reward-function).
We envision the majority of users focusing their effort on creative design of the `calculate_reward()` function [details here](#creating-a-custom-reward-function), while leaving the rest of the environment untouched. Other users may not touch the environment at all, and they will only play with the configuration settings and the powerful feature engineering that already exists in FreqAI. Meanwhile, we enable advanced users to create their own model classes entirely.
The framework is built on stable_baselines3 (torch) and OpenAI gym for the base environment class. But generally speaking, the model class is well isolated. Thus, the addition of competing libraries can be easily integrated into the existing framework. For the environment, it is inheriting from `gym.Env` which means that it is necessary to write an entirely new environment in order to switch to a different library.
### Important considerations
As explained above, the agent is "trained" in an artificial trading "environment". In our case, that environment may seem quite similar to a real Freqtrade backtesting environment, but it is *NOT*. In fact, the RL training environment is much more simplified. It does not incorporate any of the complicated strategy logic, such as callbacks like `custom_exit`, `custom_stoploss`, leverage controls, etc. The RL environment is instead a very "raw" representation of the true market, where the agent has free will to learn the policy (read: stoploss, take profit, etc.) which is enforced by the `calculate_reward()`. Thus, it is important to consider that the agent training environment is not identical to the real world.
## Running Reinforcement Learning
Setting up and running a Reinforcement Learning model is the same as running a Regressor or Classifier. The same two flags, `--freqaimodel` and `--strategy`, must be defined on the command line:
where `ReinforcementLearner` will use the templated `ReinforcementLearner` from `freqai/prediction_models/ReinforcementLearner` (or a custom user defined one located in `user_data/freqaimodels`). The strategy, on the other hand, follows the same base [feature engineering](freqai-feature-engineering.md) with `feature_engineering_*` as a typical Regressor. The difference lies in the creation of the targets, Reinforcement Learning doesn't require them. However, FreqAI requires a default (neutral) value to be set in the action column:
# For RL, there are no direct targets to set. This is filler (neutral)
# until the agent sends an action.
dataframe["&-action"]=0
returndataframe
```
Most of the function remains the same as for typical Regressors, however, the function below shows how the strategy must pass the raw price data to the agent so that it has access to raw OHLCV in the training environment:
# The following features are necessary for RL models
dataframe[f"%-raw_close"]=dataframe["close"]
dataframe[f"%-raw_open"]=dataframe["open"]
dataframe[f"%-raw_high"]=dataframe["high"]
dataframe[f"%-raw_low"]=dataframe["low"]
returndataframe
```
Finally, there is no explicit "label" to make - instead it is necessary to assign the `&-action` column which will contain the agent's actions when accessed in `populate_entry/exit_trends()`. In the present example, the neutral action to 0. This value should align with the environment used. FreqAI provides two environments, both use 0 as the neutral action.
After users realize there are no labels to set, they will soon understand that the agent is making its "own" entry and exit decisions. This makes strategy construction rather simple. The entry and exit signals come from the agent in the form of an integer - which are used directly to decide entries and exits in the strategy:
It is important to consider that `&-action` depends on which environment they choose to use. The example above shows 5 actions, where 0 is neutral, 1 is enter long, 2 is exit long, 3 is enter short and 4 is exit short.
## Configuring the Reinforcement Learner
In order to configure the `Reinforcement Learner` the following dictionary must exist in the `freqai` config:
```json
"rl_config":{
"train_cycles":25,
"add_state_info":true,
"max_trade_duration_candles":300,
"max_training_drawdown_pct":0.02,
"cpu_count":8,
"model_type":"PPO",
"policy_type":"MlpPolicy",
"model_reward_parameters":{
"rr":1,
"profit_aim":0.025
}
}
```
Parameter details can be found [here](freqai-parameter-table.md), but in general the `train_cycles` decides how many times the agent should cycle through the candle data in its artificial environment to train weights in the model. `model_type` is a string which selects one of the available models in [stable_baselines](https://stable-baselines3.readthedocs.io/en/master/)(external link).
!!! Note
If you would like to experiment with `continual_learning`, then you should set that value to `true` in the main `freqai` configuration dictionary. This will tell the Reinforcement Learning library to continue training new models from the final state of previous models, instead of retraining new models from scratch each time a retrain is initiated.
!!! Note
Remember that the general `model_training_parameters` dictionary should contain all the model hyperparameter customizations for the particular `model_type`. For example, `PPO` parameters can be found [here](https://stable-baselines3.readthedocs.io/en/master/modules/ppo.html).
## Creating a custom reward function
!!! danger "Not for production"
Warning!
The reward function provided with the Freqtrade source code is a showcase of functionality designed to show/test as many possible environment control features as possible. It is also designed to run quickly on small computers. This is a benchmark, it is *not* for live production. Please beware that you will need to create your own custom_reward() function or use a template built by other users outside of the Freqtrade source code.
As you begin to modify the strategy and the prediction model, you will quickly realize some important differences between the Reinforcement Learner and the Regressors/Classifiers. Firstly, the strategy does not set a target value (no labels!). Instead, you set the `calculate_reward()` function inside the `MyRLEnv` class (see below). A default `calculate_reward()` is provided inside `prediction_models/ReinforcementLearner.py` to demonstrate the necessary building blocks for creating rewards, but this is *not* designed for production. Users *must* create their own custom reinforcement learning model class or use a pre-built one from outside the Freqtrade source code and save it to `user_data/freqaimodels`. It is inside the `calculate_reward()` where creative theories about the market can be expressed. For example, you can reward your agent when it makes a winning trade, and penalize the agent when it makes a losing trade. Or perhaps, you wish to reward the agent for entering trades, and penalize the agent for sitting in trades too long. Below we show examples of how these rewards are all calculated:
!!! note "Hint"
The best reward functions are ones that are continuously differentiable, and well scaled. In other words, adding a single large negative penalty to a rare event is not a good idea, and the neural net will not be able to learn that function. Instead, it is better to add a small negative penalty to a common event. This will help the agent learn faster. Not only this, but you can help improve the continuity of your rewards/penalties by having them scale with severity according to some linear/exponential functions. In other words, you'd slowly scale the penalty as the duration of the trade increases. This is better than a single large penalty occuring at a single point in time.
Reinforcement Learning models benefit from tracking training metrics. FreqAI has integrated Tensorboard to allow users to track training and evaluation performance across all coins and across all retrainings. Tensorboard is activated via the following command:
```bash
cd freqtrade
tensorboard --logdir user_data/models/unique-id
```
where `unique-id` is the `identifier` set in the `freqai` configuration file. This command must be run in a separate shell to view the output in their browser at 127.0.0.1:6006 (6006 is the default port used by Tensorboard).

## Custom logging
FreqAI also provides a built in episodic summary logger called `self.tensorboard_log` for adding custom information to the Tensorboard log. By default, this function is already called once per step inside the environment to record the agent actions. All values accumulated for all steps in a single episode are reported at the conclusion of each episode, followed by a full reset of all metrics to 0 in preparation for the subsequent episode.
`self.tensorboard_log` can also be used anywhere inside the environment, for example, it can be added to the `calculate_reward` function to collect more detailed information about how often various parts of the reward were called:
```python
classMyRLEnv(Base5ActionRLEnv):
"""
User made custom environment. This class inherits from BaseEnvironment and gym.Env.
Users can override any functions from those parent classes. Here is an example
of a user customized `calculate_reward()` function.
"""
defcalculate_reward(self,action:int)->float:
ifnotself._is_valid(action):
self.tensorboard_log("invalid")
return-2
```
!!! Note
The `self.tensorboard_log()` function is designed for tracking incremented objects only i.e. events, actions inside the training environment. If the event of interest is a float, the float can be passed as the second argument e.g. `self.tensorboard_log("float_metric1", 0.23)`. In this case the metric values are not incremented.
## Choosing a base environment
FreqAI provides three base environments, `Base3ActionRLEnvironment`, `Base4ActionEnvironment` and `Base5ActionEnvironment`. As the names imply, the environments are customized for agents that can select from 3, 4 or 5 actions. The `Base3ActionEnvironment` is the simplest, the agent can select from hold, long, or short. This environment can also be used for long-only bots (it automatically follows the `can_short` flag from the strategy), where long is the enter condition and short is the exit condition. Meanwhile, in the `Base4ActionEnvironment`, the agent can enter long, enter short, hold neutral, or exit position. Finally, in the `Base5ActionEnvironment`, the agent has the same actions as Base4, but instead of a single exit action, it separates exit long and exit short. The main changes stemming from the environment selection include:
* the actions available in the `calculate_reward`
* the actions consumed by the user strategy
All of the FreqAI provided environments inherit from an action/position agnostic environment object called the `BaseEnvironment`, which contains all shared logic. The architecture is designed to be easily customized. The simplest customization is the `calculate_reward()` (see details [here](#creating-a-custom-reward-function)). However, the customizations can be further extended into any of the functions inside the environment. You can do this by simply overriding those functions inside your `MyRLEnv` in the prediction model file. Or for more advanced customizations, it is encouraged to create an entirely new environment inherited from `BaseEnvironment`.
!!! Note
Only the `Base3ActionRLEnv` can do long-only training/trading (set the user strategy attribute `can_short = False`).
There are two ways to train and deploy an adaptive machine learning model - live deployment and historical backtesting. In both cases, FreqAI runs/simulates periodic retraining of models as shown in the following figure:

## Live deployments
FreqAI can be run dry/live using the following command:
When launched, FreqAI will start training a new model, with a new `identifier`, based on the config settings. Following training, the model will be used to make predictions on incoming candles until a new model is available. New models are typically generated as often as possible, with FreqAI managing an internal queue of the coin pairs to try to keep all models equally up to date. FreqAI will always use the most recently trained model to make predictions on incoming live data. If you do not want FreqAI to retrain new models as often as possible, you can set `live_retrain_hours` to tell FreqAI to wait at least that number of hours before training a new model. Additionally, you can set `expired_hours` to tell FreqAI to avoid making predictions on models that are older than that number of hours.
Trained models are by default saved to disk to allow for reuse during backtesting or after a crash. You can opt to [purge old models](#purging-old-model-data) to save disk space by setting `"purge_old_models": true` in the config.
To start a dry/live run from a saved backtest model (or from a previously crashed dry/live session), you only need to specify the `identifier` of the specific model:
```json
"freqai":{
"identifier":"example",
"live_retrain_hours":0.5
}
```
In this case, although FreqAI will initiate with a pre-trained model, it will still check to see how much time has elapsed since the model was trained. If a full `live_retrain_hours` has elapsed since the end of the loaded model, FreqAI will start training a new model.
### Automatic data download
FreqAI automatically downloads the proper amount of data needed to ensure training of a model through the defined `train_period_days` and `startup_candle_count` (see the [parameter table](freqai-parameter-table.md) for detailed descriptions of these parameters).
### Saving prediction data
All predictions made during the lifetime of a specific `identifier` model are stored in `historic_predictions.pkl` to allow for reloading after a crash or changes made to the config.
### Purging old model data
FreqAI stores new model files after each successful training. These files become obsolete as new models are generated to adapt to new market conditions. If you are planning to leave FreqAI running for extended periods of time with high frequency retraining, you should enable `purge_old_models` in the config:
```json
"freqai":{
"purge_old_models":true,
}
```
This will automatically purge all models older than the two most recently trained ones to save disk space.
## Backtesting
The FreqAI backtesting module can be executed with the following command:
If this command has never been executed with the existing config file, FreqAI will train a new model
for each pair, for each backtesting window within the expanded `--timerange`.
Backtesting mode requires [downloading the necessary data](#downloading-data-to-cover-the-full-backtest-period) before deployment (unlike in dry/live mode where FreqAI handles the data downloading automatically). You should be careful to consider that the time range of the downloaded data is more than the backtesting time range. This is because FreqAI needs data prior to the desired backtesting time range in order to train a model to be ready to make predictions on the first candle of the set backtesting time range. More details on how to calculate the data to download can be found [here](#deciding-the-size-of-the-sliding-training-window-and-backtesting-duration).
!!! Note "Model reuse"
Once the training is completed, you can execute the backtesting again with the same config file and
FreqAI will find the trained models and load them instead of spending time training. This is useful
if you want to tweak (or even hyperopt) buy and sell criteria inside the strategy. If you
*want* to retrain a new model with the same config file, you should simply change the `identifier`.
This way, you can return to using any model you wish by simply specifying the `identifier`.
!!! Note
Backtesting calls `set_freqai_targets()` one time for each backtest window (where the number of windows is the full backtest timerange divided by the `backtest_period_days` parameter). Doing this means that the targets simulate dry/live behavior without look ahead bias. However, the definition of the features in `feature_engineering_*()` is performed once on the entire backtest timerange. This means that you should be sure that features do look-ahead into the future.
More details about look-ahead bias can be found in [Common Mistakes](strategy-customization.md#common-mistakes-when-developing-strategies).
---
### Saving prediction data
To allow for tweaking your strategy (**not** the features!), FreqAI will automatically save the predictions during backtesting so that they can be reused for future backtests and live runs using the same `identifier` model. This provides a performance enhancement geared towards enabling **high-level hyperopting** of entry/exit criteria.
An additional directory called `backtesting_predictions`, which contains all the predictions stored in `hdf` format, will be created in the `unique-id` folder.
To change your **features**, you **must** set a new `identifier` in the config to signal to FreqAI to train new models.
To save the models generated during a particular backtest so that you can start a live deployment from one of them instead of training a new model, you must set `save_backtest_models` to `True` in the config.
### Backtest live collected predictions
FreqAI allow you to reuse live historic predictions through the backtest parameter `--freqai-backtest-live-models`. This can be useful when you want to reuse predictions generated in dry/run for comparison or other study.
The `--timerange` parameter must not be informed, as it will be automatically calculated through the data in the historic predictions file.
### Downloading data to cover the full backtest period
For live/dry deployments, FreqAI will download the necessary data automatically. However, to use backtesting functionality, you need to download the necessary data using `download-data` (details [here](data-download.md#data-downloading)). You need to pay careful attention to understanding how much *additional* data needs to be downloaded to ensure that there is a sufficient amount of training data *before* the start of the backtesting time range. The amount of additional data can be roughly estimated by moving the start date of the time range backwards by `train_period_days` and the `startup_candle_count` (see the [parameter table](freqai-parameter-table.md) for detailed descriptions of these parameters) from the beginning of the desired backtesting time range.
As an example, to backtest the `--timerange 20210501-20210701` using the [example config](freqai-configuration.md#setting-up-the-configuration-file) which sets `train_period_days` to 30, together with `startup_candle_count: 40` on a maximum `include_timeframes` of 1h, the start date for the downloaded data needs to be `20210501` - 30 days - 40 * 1h / 24 hours = 20210330 (31.7 days earlier than the start of the desired training time range).
### Deciding the size of the sliding training window and backtesting duration
The backtesting time range is defined with the typical `--timerange` parameter in the configuration file. The duration of the sliding training window is set by `train_period_days`, whilst `backtest_period_days` is the sliding backtesting window, both in number of days (`backtest_period_days` can be
a float to indicate sub-daily retraining in live/dry mode). In the presented [example config](freqai-configuration.md#setting-up-the-configuration-file) (found in `config_examples/config_freqai.example.json`), the user is asking FreqAI to use a training period of 30 days and backtest on the subsequent 7 days. After the training of the model, FreqAI will backtest the subsequent 7 days. The "sliding window" then moves one week forward (emulating FreqAI retraining once per week in live mode) and the new model uses the previous 30 days (including the 7 days used for backtesting by the previous model) to train. This is repeated until the end of `--timerange`. This means that if you set `--timerange 20210501-20210701`, FreqAI will have trained 8 separate models at the end of `--timerange` (because the full range comprises 8 weeks).
!!! Note
Although fractional `backtest_period_days` is allowed, you should be aware that the `--timerange` is divided by this value to determine the number of models that FreqAI will need to train in order to backtest the full range. For example, by setting a `--timerange` of 10 days, and a `backtest_period_days` of 0.1, FreqAI will need to train 100 models per pair to complete the full backtest. Because of this, a true backtest of FreqAI adaptive training would take a *very* long time. The best way to fully test a model is to run it dry and let it train constantly. In this case, backtesting would take the exact same amount of time as a dry run.
## Defining model expirations
During dry/live mode, FreqAI trains each coin pair sequentially (on separate threads/GPU from the main Freqtrade bot). This means that there is always an age discrepancy between models. If you are training on 50 pairs, and each pair requires 5 minutes to train, the oldest model will be over 4 hours old. This may be undesirable if the characteristic time scale (the trade duration target) for a strategy is less than 4 hours. You can decide to only make trade entries if the model is less than a certain number of hours old by setting the `expiration_hours` in the config file:
```json
"freqai":{
"expiration_hours":0.5,
}
```
In the presented example config, the user will only allow predictions on models that are less than 1/2 hours old.
## Controlling the model learning process
Model training parameters are unique to the selected machine learning library. FreqAI allows you to set any parameter for any library using the `model_training_parameters` dictionary in the config. The example config (found in `config_examples/config_freqai.example.json`) shows some of the example parameters associated with `Catboost` and `LightGBM`, but you can add any parameters available in those libraries or any other machine learning library you choose to implement.
Data split parameters are defined in `data_split_parameters` which can be any parameters associated with scikit-learn's `train_test_split()` function. `train_test_split()` has a parameters called `shuffle` which allows to shuffle the data or keep it unshuffled. This is particularly useful to avoid biasing training with temporally auto-correlated data. More details about these parameters can be found the [scikit-learn website](https://scikit-learn.org/stable/modules/generated/sklearn.model_selection.train_test_split.html) (external website).
The FreqAI specific parameter `label_period_candles` defines the offset (number of candles into the future) used for the `labels`. In the presented [example config](freqai-configuration.md#setting-up-the-configuration-file), the user is asking for `labels` that are 24 candles in the future.
## Continual learning
You can choose to adopt a continual learning scheme by setting `"continual_learning": true` in the config. By enabling `continual_learning`, after training an initial model from scratch, subsequent trainings will start from the final model state of the preceding training. This gives the new model a "memory" of the previous state. By default, this is set to `False` which means that all new models are trained from scratch, without input from previous models.
???+ danger "Continual learning enforces a constant parameter space"
Since `continual_learning` means that the model parameter space *cannot* change between trainings, `principal_component_analysis` is automatically disabled when `continual_learning` is enabled. Hint: PCA changes the parameter space and the number of features, learn more about PCA [here](freqai-feature-engineering.md#data-dimensionality-reduction-with-principal-component-analysis).
???+ danger "Experimental functionality"
Beware that this is currently a naive approach to incremental learning, and it has a high probability of overfitting/getting stuck in local minima while the market moves away from your model. We have the mechanics available in FreqAI primarily for experimental purposes and so that it is ready for more mature approaches to continual learning in chaotic systems like the crypto market.
## Hyperopt
You can hyperopt using the same command as for [typical Freqtrade hyperopt](hyperopt.md):
`hyperopt` requires you to have the data pre-downloaded in the same fashion as if you were doing [backtesting](#backtesting). In addition, you must consider some restrictions when trying to hyperopt FreqAI strategies:
- The `--analyze-per-epoch` hyperopt parameter is not compatible with FreqAI.
- It's not possible to hyperopt indicators in the `feature_engineering_*()` and `set_freqai_targets()` functions. This means that you cannot optimize model parameters using hyperopt. Apart from this exception, it is possible to optimize all other [spaces](hyperopt.md#running-hyperopt-with-smaller-search-space).
- The backtesting instructions also apply to hyperopt.
The best method for combining hyperopt and FreqAI is to focus on hyperopting entry/exit thresholds/criteria. You need to focus on hyperopting parameters that are not used in your features. For example, you should not try to hyperopt rolling window lengths in the feature creation, or any part of the FreqAI config which changes predictions. In order to efficiently hyperopt the FreqAI strategy, FreqAI stores predictions as dataframes and reuses them. Hence the requirement to hyperopt entry/exit thresholds/criteria only.
A good example of a hyperoptable parameter in FreqAI is a threshold for the [Dissimilarity Index (DI)](freqai-feature-engineering.md#identifying-outliers-with-the-dissimilarity-index-di) `DI_values` beyond which we consider data points as outliers:
This specific hyperopt would help you understand the appropriate `DI_values` for your particular parameter space.
## Using Tensorboard
!!! note "Availability"
FreqAI includes tensorboard for a variety of models, including XGBoost, all PyTorch models, Reinforcement Learning, and Catboost. If you would like to see Tensorboard integrated into another model type, please open an issue on the [Freqtrade GitHub](https://github.com/freqtrade/freqtrade/issues)
!!! danger "Requirements"
Tensorboard logging requires the FreqAI torch installation/docker image.
The easiest way to use tensorboard is to ensure `freqai.activate_tensorboard` is set to `True` (default setting) in your configuration file, run FreqAI, then open a separate shell and run:
```bash
cd freqtrade
tensorboard --logdir user_data/models/unique-id
```
where `unique-id` is the `identifier` set in the `freqai` configuration file. This command must be run in a separate shell if you wish to view the output in your browser at 127.0.0.1:6060 (6060 is the default port used by Tensorboard).

!!! note "Deactivate for improved performance"
Tensorboard logging can slow down training and should be deactivated for production use.
FreqAI is a software designed to automate a variety of tasks associated with training a predictive machine learning model to generate market forecasts given a set of input signals. In general, FreqAI aims to be a sandbox for easily deploying robust machine learning libraries on real-time data ([details](#freqai-position-in-open-source-machine-learning-landscape)).
!!! Note
FreqAI is, and always will be, a not-for-profit, open-source project. FreqAI does *not* have a crypto token, FreqAI does *not* sell signals, and FreqAI does not have a domain besides the present [freqtrade documentation](https://www.freqtrade.io/en/latest/freqai/).
Features include:
* **Self-adaptive retraining** - Retrain models during [live deployments](freqai-running.md#live-deployments) to self-adapt to the market in a supervised manner
* **Rapid feature engineering** - Create large rich [feature sets](freqai-feature-engineering.md#feature-engineering) (10k+ features) based on simple user-created strategies
* **High performance** - Threading allows for adaptive model retraining on a separate thread (or on GPU if available) from model inferencing (prediction) and bot trade operations. Newest models and data are kept in RAM for rapid inferencing
* **Realistic backtesting** - Emulate self-adaptive training on historic data with a [backtesting module](freqai-running.md#backtesting) that automates retraining
* **Extensibility** - The generalized and robust architecture allows for incorporating any [machine learning library/method](freqai-configuration.md#using-different-prediction-models) available in Python. Eight examples are currently available, including classifiers, regressors, and a convolutional neural network
* **Smart outlier removal** - Remove outliers from training and prediction data sets using a variety of [outlier detection techniques](freqai-feature-engineering.md#outlier-detection)
* **Crash resilience** - Store trained models to disk to make reloading from a crash fast and easy, and [purge obsolete files](freqai-running.md#purging-old-model-data) for sustained dry/live runs
* **Automatic data normalization** - [Normalize the data](freqai-feature-engineering.md#feature-normalization) in a smart and statistically safe way
* **Automatic data download** - Compute timeranges for data downloads and update historic data (in live deployments)
* **Cleaning of incoming data** - Handle NaNs safely before training and model inferencing
* **Dimensionality reduction** - Reduce the size of the training data via [Principal Component Analysis](freqai-feature-engineering.md#data-dimensionality-reduction-with-principal-component-analysis)
* **Deploying bot fleets** - Set one bot to train models while a fleet of [consumers](producer-consumer.md) use signals.
## Quick start
The easiest way to quickly test FreqAI is to run it in dry mode with the following command:
You will see the boot-up process of automatic data downloading, followed by simultaneous training and trading.
!!! danger "Not for production"
The example strategy provided with the Freqtrade source code is designed for showcasing/testing a wide variety of FreqAI features. It is also designed to run on small computers so that it can be used as a benchmark between developers and users. It is *not* designed to be run in production.
An example strategy, prediction model, and config to use as a starting points can be found in
`freqtrade/templates/FreqaiExampleStrategy.py`, `freqtrade/freqai/prediction_models/LightGBMRegressor.py`, and
You provide FreqAI with a set of custom *base indicators* (the same way as in a [typical Freqtrade strategy](strategy-customization.md)) as well as target values (*labels*). For each pair in the whitelist, FreqAI trains a model to predict the target values based on the input of custom indicators. The models are then consistently retrained, with a predetermined frequency, to adapt to market conditions. FreqAI offers the ability to both backtest strategies (emulating reality with periodic retraining on historic data) and deploy dry/live runs. In dry/live conditions, FreqAI can be set to constant retraining in a background thread to keep models as up to date as possible.
An overview of the algorithm, explaining the data processing pipeline and model usage, is shown below.

### Important machine learning vocabulary
**Features** - the parameters, based on historic data, on which a model is trained. All features for a single candle are stored as a vector. In FreqAI, you build a feature data set from anything you can construct in the strategy.
**Labels** - the target values that the model is trained toward. Each feature vector is associated with a single label that is defined by you within the strategy. These labels intentionally look into the future and are what you are training the model to be able to predict.
**Training** - the process of "teaching" the model to match the feature sets to the associated labels. Different types of models "learn" in different ways which means that one might be better than another for a specific application. More information about the different models that are already implemented in FreqAI can be found [here](freqai-configuration.md#using-different-prediction-models).
**Train data** - a subset of the feature data set that is fed to the model during training to "teach" the model how to predict the targets. This data directly influences weight connections in the model.
**Test data** - a subset of the feature data set that is used to evaluate the performance of the model after training. This data does not influence nodal weights within the model.
**Inferencing** - the process of feeding a trained model new unseen data on which it will make a prediction.
## Install prerequisites
The normal Freqtrade install process will ask if you wish to install FreqAI dependencies. You should reply "yes" to this question if you wish to use FreqAI. If you did not reply yes, you can manually install these dependencies after the install with:
``` bash
pip install -r requirements-freqai.txt
```
!!! Note
Catboost will not be installed on low-powered arm devices (raspberry), since it does not provide wheels for this platform.
### Usage with docker
If you are using docker, a dedicated tag with FreqAI dependencies is available as `:freqai`. As such - you can replace the image line in your docker compose file with `image: freqtradeorg/freqtrade:develop_freqai`. This image contains the regular FreqAI dependencies. Similar to native installs, Catboost will not be available on ARM based devices. If you would like to use PyTorch or Reinforcement learning, you should use the torch or RL tags, `image: freqtradeorg/freqtrade:develop_freqaitorch`, `image: freqtradeorg/freqtrade:develop_freqairl`.
!!! note "docker-compose-freqai.yml"
We do provide an explicit docker-compose file for this in `docker/docker-compose-freqai.yml` - which can be used via `docker compose -f docker/docker-compose-freqai.yml run ...` - or can be copied to replace the original docker file. This docker-compose file also contains a (disabled) section to enable GPU resources within docker containers. This obviously assumes the system has GPU resources available.
### FreqAI position in open-source machine learning landscape
Forecasting chaotic time-series based systems, such as equity/cryptocurrency markets, requires a broad set of tools geared toward testing a wide range of hypotheses. Fortunately, a recent maturation of robust machine learning libraries (e.g. `scikit-learn`) has opened up a wide range of research possibilities. Scientists from a diverse range of fields can now easily prototype their studies on an abundance of established machine learning algorithms. Similarly, these user-friendly libraries enable "citzen scientists" to use their basic Python skills for data exploration. However, leveraging these machine learning libraries on historical and live chaotic data sources can be logistically difficult and expensive. Additionally, robust data collection, storage, and handling presents a disparate challenge. [`FreqAI`](#freqai) aims to provide a generalized and extensible open-sourced framework geared toward live deployments of adaptive modeling for market forecasting. The `FreqAI` framework is effectively a sandbox for the rich world of open-source machine learning libraries. Inside the `FreqAI` sandbox, users find they can combine a wide variety of third-party libraries to test creative hypotheses on a free live 24/7 chaotic data source - cryptocurrency exchange data.
### Citing FreqAI
FreqAI is [published in the Journal of Open Source Software](https://joss.theoj.org/papers/10.21105/joss.04864). If you find FreqAI useful in your research, please use the following citation:
```bibtex
@article{Caulk2022,
doi = {10.21105/joss.04864},
url = {https://doi.org/10.21105/joss.04864},
year = {2022}, publisher = {The Open Journal},
volume = {7}, number = {80}, pages = {4864},
author = {Robert A. Caulk and Elin Törnquist and Matthias Voppichler and Andrew R. Lawless and Ryan McMullan and Wagner Costa Santos and Timothy C. Pogue and Johan van der Vlugt and Stefan P. Gehring and Pascal Schmidt},
title = {FreqAI: generalizing adaptive modeling for chaotic time-series market forecasts},
journal = {Journal of Open Source Software} }
```
## Common pitfalls
FreqAI cannot be combined with dynamic `VolumePairlists` (or any pairlist filter that adds and removes pairs dynamically).
This is for performance reasons - FreqAI relies on making quick predictions/retrains. To do this effectively,
it needs to download all the training data at the beginning of a dry/live instance. FreqAI stores and appends
new candles automatically for future retrains. This means that if new pairs arrive later in the dry run due to a volume pairlist, it will not have the data ready. However, FreqAI does work with the `ShufflePairlist` or a `VolumePairlist` which keeps the total pairlist constant (but reorders the pairs according to volume).
## Additional learning materials
Here we compile some external materials that provide deeper looks into various components of FreqAI:
- [Real-time head-to-head: Adaptive modeling of financial market data using XGBoost and CatBoost](https://emergentmethods.medium.com/real-time-head-to-head-adaptive-modeling-of-financial-market-data-using-xgboost-and-catboost-995a115a7495)
- [FreqAI - from price to prediction](https://emergentmethods.medium.com/freqai-from-price-to-prediction-6fadac18b665)
## Credits
FreqAI is developed by a group of individuals who all contribute specific skillsets to the project.
Conception and software development:
Robert Caulk @robcaulk
Theoretical brainstorming and data analysis:
Elin Törnquist @th0rntwig
Code review and software architecture brainstorming:
@xmatthias
Software development:
Wagner Costa @wagnercosta
Emre Suzen @aemr3
Timothy Pogue @wizrds
Beta testing and bug reporting:
Stefan Gehring @bloodhunter4rc, @longyu, Andrew Lawless @paranoidandy, Pascal Schmidt @smidelis, Ryan McMullan @smarmau, Juha Nykänen @suikula, Johan van der Vlugt @jooopiert, Richárd Józsa @richardjosza
Recursively search for a strategy in the strategies
folder.
--freqaimodel NAME Specify a custom freqaimodels.
--freqaimodel-path PATH
Specify additional lookup path for freqaimodels.
```
@@ -149,8 +168,8 @@ Checklist on all tasks / possibilities in hyperopt
Depending on the space you want to optimize, only some of the below are required:
* define parameters with `space='buy'` - for buy signal optimization
* define parameters with `space='sell'` - for sell signal optimization
* define parameters with `space='buy'` - for entry signal optimization
* define parameters with `space='sell'` - for exit signal optimization
!!! Note
`populate_indicators` needs to create all indicators any of the spaces may use, otherwise hyperopt will not work.
@@ -161,6 +180,7 @@ Rarely you may also need to create a [nested class](advanced-hyperopt.md#overrid
*`generate_roi_table` - for custom ROI optimization (if you need the ranges for the values in the ROI table that differ from default or the number of entries (steps) in the ROI table which differs from the default 4 steps)
*`stoploss_space` - for custom stoploss optimization (if you need the range for the stoploss parameter in the optimization hyperspace that differs from default)
*`trailing_space` - for custom trailing stop optimization (if you need the ranges for the trailing stop parameters in the optimization hyperspace that differ from default)
*`max_open_trades_space` - for custom max_open_trades optimization (if you need the ranges for the max_open_trades parameter in the optimization hyperspace that differ from default)
!!! Tip "Quickly optimize ROI, stoploss and trailing stoploss"
You can quickly optimize the spaces `roi`, `stoploss` and `trailing` without changing anything in your strategy.
@@ -172,11 +192,11 @@ Rarely you may also need to create a [nested class](advanced-hyperopt.md#overrid
### Hyperopt execution logic
Hyperopt will first load your data into memory and will then run `populate_indicators()` once per Pair to generate all indicators.
Hyperopt will first load your data into memory and will then run `populate_indicators()` once per Pair to generate all indicators, unless `--analyze-per-epoch` is specified.
Hyperopt will then spawn into different processes (number of processors, or `-j <n>`), and run backtesting over and over again, changing the parameters that are part of the `--spaces` defined.
For every new set of parameters, freqtrade will run first `populate_buy_trend()` followed by `populate_sell_trend()`, and then run the regular backtesting process to simulate trades.
For every new set of parameters, freqtrade will run first `populate_entry_trend()` followed by `populate_exit_trend()`, and then run the regular backtesting process to simulate trades.
After backtesting, the results are passed into the [loss function](#loss-functions), which will evaluate if this result was better or worse than previous results.
Based on the loss function result, hyperopt will determine the next set of parameters to try in the next round of backtesting.
@@ -186,7 +206,7 @@ Based on the loss function result, hyperopt will determine the next set of param
There are two places you need to change in your strategy file to add a new buy hyperopt for testing:
* Define the parameters at the class level hyperopt shall be optimizing.
* Within `populate_buy_trend()` - use defined parameter values instead of raw constants.
* Within `populate_entry_trend()` - use defined parameter values instead of raw constants.
There you have two different types of indicators: 1. `guards` and 2. `triggers`.
@@ -196,25 +216,25 @@ There you have two different types of indicators: 1. `guards` and 2. `triggers`.
!!! Hint "Guards and Triggers"
Technically, there is no difference between Guards and Triggers.
However, this guide will make this distinction to make it clear that signals should not be "sticking".
Sticking signals are signals that are active for multiple candles. This can lead into buying a signal late (right before the signal disappears - which means that the chance of success is a lot lower than right at the beginning).
Sticking signals are signals that are active for multiple candles. This can lead into entering a signal late (right before the signal disappears - which means that the chance of success is a lot lower than right at the beginning).
Hyper-optimization will, for each epoch round, pick one trigger and possibly multiple guards.
#### Sell optimization
#### Exit signal optimization
Similar to the buy-signal above, sell-signals can also be optimized.
Similar to the entry-signal above, exit-signals can also be optimized.
Place the corresponding settings into the following methods
* Define the parameters at the class level hyperopt shall be optimizing, either naming them `sell_*`, or by explicitly defining `space='sell'`.
* Within `populate_sell_trend()` - use defined parameter values instead of raw constants.
* Within `populate_exit_trend()` - use defined parameter values instead of raw constants.
The configuration and rules are the same than for buy signals.
## Solving a Mystery
Let's say you are curious: should you use MACD crossings or lower Bollinger Bands to trigger your buys.
And you also wonder should you use RSI or ADX to help with those buy decisions.
If you decide to use RSI or ADX, which values should I use for them?
Let's say you are curious: should you use MACD crossings or lower Bollinger Bands to trigger your long entries.
And you also wonder should you use RSI or ADX to help with those decisions.
If you decide to use RSI or ADX, which values should I use for them?
So let's use hyperparameter optimization to solve this mystery.
@@ -251,7 +271,7 @@ We continue to define hyperoptable parameters:
@@ -265,12 +285,13 @@ The last one we call `trigger` and use it to decide which buy trigger we want to
!!! Note "Parameter space assignment"
Parameters must either be assigned to a variable named `buy_*` or `sell_*` - or contain `space='buy'` | `space='sell'` to be assigned to a space correctly.
If no parameter is available for a space, you'll receive the error that no space was found when running hyperopt.
If no parameter is available for a space, you'll receive the error that no space was found when running hyperopt.
Parameters with unclear space (e.g. `adx_period = IntParameter(4, 24, default=14)` - no explicit nor implicit space) will not be detected and will therefore be ignored.
So let's write the buy strategy using these values:
@@ -292,12 +313,12 @@ So let's write the buy strategy using these values:
if conditions:
dataframe.loc[
reduce(lambda x, y: x & y, conditions),
'buy'] = 1
'enter_long'] = 1
return dataframe
```
Hyperopt will now call `populate_buy_trend()` many times (`epochs`) with different value combinations.
Hyperopt will now call `populate_entry_trend()` many times (`epochs`) with different value combinations.
It will use the given historical data and simulate buys based on the buy signals generated with the above function.
Based on the results, hyperopt will tell you which parameter combination produced the best results (based on the configured [loss function](#loss-functions)).
@@ -314,6 +335,7 @@ There are four parameter types each suited for different purposes.
* `DecimalParameter` - defines a floating point parameter with a limited number of decimals (default 3). Should be preferred instead of `RealParameter` in most cases.
* `RealParameter` - defines a floating point parameter with upper and lower boundaries and no precision limit. Rarely used as it creates a space with a near infinite number of possibilities.
* `CategoricalParameter` - defines a parameter with a predetermined number of choices.
* `BooleanParameter` - Shorthand for `CategoricalParameter([True, False])` - great for "enable" parameters.
!!! Tip "Disabling parameter optimization"
Each parameter takes two boolean parameters:
@@ -324,9 +346,10 @@ There are four parameter types each suited for different purposes.
!!! Warning
Hyperoptable parameters cannot be used in `populate_indicators` - as hyperopt does not recalculate indicators for each epoch, so the starting value would be used in this case.
### Optimizing an indicator parameter
## Optimizing an indicator parameter
Assuming you have a simple strategy in mind - a EMA cross strategy (2 Moving averages crossing) - and you'd like to find the ideal parameters for this strategy.
By default, we assume a stoploss of 5% - and a take-profit (`minimal_roi`) of 10% - which means freqtrade will sell the trade once 10% profit has been reached.
``` python
from pandas import DataFrame
@@ -334,13 +357,16 @@ from functools import reduce
import talib.abstract as ta
from freqtrade.strategy import IStrategy
from freqtrade.strategy import CategoricalParameter, DecimalParameter, IntParameter
from freqtrade.strategy import (BooleanParameter, CategoricalParameter, DecimalParameter,
IStrategy, IntParameter)
import freqtrade.vendor.qtpylib.indicators as qtpylib
class MyAwesomeStrategy(IStrategy):
stoploss = -0.05
timeframe = '15m'
minimal_roi = {
"0": 0.10
}
# Define the parameter spaces
buy_ema_short = IntParameter(3, 50, default=5)
buy_ema_long = IntParameter(15, 200, default=50)
@@ -359,7 +385,7 @@ class MyAwesomeStrategy(IStrategy):
@@ -386,7 +412,7 @@ class MyAwesomeStrategy(IStrategy):
if conditions:
dataframe.loc[
reduce(lambda x, y: x & y, conditions),
'sell'] = 1
'exit_long'] = 1
return dataframe
```
@@ -396,17 +422,158 @@ Using `self.buy_ema_short.range` will return a range object containing all entri
In this case (`IntParameter(3, 50, default=5)`), the loop would run for all numbers between 3 and 50 (`[3, 4, 5, ... 49, 50]`).
By using this in a loop, hyperopt will generate 48 new columns (`['buy_ema_3', 'buy_ema_4', ... , 'buy_ema_50']`).
Hyperopt itself will then use the selected value to create the buy and sell signals
Hyperopt itself will then use the selected value to create the buy and sell signals.
While this strategy is most likely too simple to provide consistent profit, it should serve as an example how optimize indicator parameters.
!!! Note
`self.buy_ema_short.range` will act differently between hyperopt and other modes. For hyperopt, the above example may generate 48 new columns, however for all other modes (backtesting, dry/live), it will only generate the column for the selected value. You should therefore avoid using the resulting column with explicit values (values other than `self.buy_ema_short.value`).
!!! Note
`range` property may also be used with `DecimalParameter` and `CategoricalParameter`. `RealParameter` does not provide this property due to infinite search space.
??? Hint "Performance tip"
By doing the calculation of all possible indicators in `populate_indicators()`, the calculation of the indicator happens only once for every parameter.
While this may slow down the hyperopt startup speed, the overall performance will increase as the Hyperopt execution itself may pick the same value for multiple epochs (changing other values).
You should however try to use space ranges as small as possible. Every new column will require more memory, and every possibility hyperopt can try will increase the search space.
During normal hyperopting, indicators are calculated once and supplied to each epoch, linearly increasing RAM usage as a factor of increasing cores. As this also has performance implications, there are two alternatives to reduce RAM usage
* Move `ema_short` and `ema_long` calculations from `populate_indicators()` to `populate_entry_trend()`. Since `populate_entry_trend()` gonna be calculated every epochs, you don't need to use `.range` functionality.
* hyperopt provides `--analyze-per-epoch` which will move the execution of `populate_indicators()` to the epoch process, calculating a single value per parameter per epoch instead of using the `.range` functionality. In this case, `.range` functionality will only return the actually used value.
These alternatives will reduce RAM usage, but increase CPU usage. However, your hyperopting run will be less likely to fail due to Out Of Memory (OOM) issues.
Whether you are using `.range` functionality or the alternatives above, you should try to use space ranges as small as possible since this will improve CPU/RAM usage.
## Optimizing protections
Freqtrade can also optimize protections. How you optimize protections is up to you, and the following should be considered as example only.
The strategy will simply need to define the "protections" entry as property returning a list of protection configurations.
``` python
from pandas import DataFrame
from functools import reduce
import talib.abstract as ta
from freqtrade.strategy import (BooleanParameter, CategoricalParameter, DecimalParameter,
IStrategy, IntParameter)
import freqtrade.vendor.qtpylib.indicators as qtpylib
The protection space is not part of the default space, and is only available with the Parameters Hyperopt interface, not with the legacy hyperopt interface (which required separate hyperopt files).
Freqtrade will also automatically change the "--enable-protections" flag if the protection space is selected.
!!! Warning
If protections are defined as property, entries from the configuration will be ignored.
It is therefore recommended to not define protections in the configuration.
### Migrating from previous property setups
A migration from a previous setup is pretty simple, and can be accomplished by converting the protections entry to a property.
In simple terms, the following configuration will be converted to the below.
``` python
class MyAwesomeStrategy(IStrategy):
protections = [
{
"method": "CooldownPeriod",
"stop_duration_candles": 4
}
]
```
Result
``` python
class MyAwesomeStrategy(IStrategy):
@property
def protections(self):
return [
{
"method": "CooldownPeriod",
"stop_duration_candles": 4
}
]
```
You will then obviously also change potential interesting entries to parameters to allow hyper-optimization.
### Optimizing `max_entry_position_adjustment`
While `max_entry_position_adjustment` is not a separate space, it can still be used in hyperopt by using the property approach shown above.
``` python
from pandas import DataFrame
from functools import reduce
import talib.abstract as ta
from freqtrade.strategy import (BooleanParameter, CategoricalParameter, DecimalParameter,
IStrategy, IntParameter)
import freqtrade.vendor.qtpylib.indicators as qtpylib
@@ -417,12 +584,16 @@ This class should be in its own file within the `user_data/hyperopts/` directory
Currently, the following loss functions are builtin:
* `ShortTradeDurHyperOptLoss` (default legacy Freqtrade hyperoptimization loss function) - Mostly for short trade duration and avoiding losses.
* `OnlyProfitHyperOptLoss` (which takes only amount of profit into consideration)
* `SharpeHyperOptLoss` (optimizes Sharpe Ratio calculated on trade returns relative to standard deviation)
* `SharpeHyperOptLossDaily` (optimizes Sharpe Ratio calculated on **daily** trade returns relative to standard deviation)
* `SortinoHyperOptLoss` (optimizes Sortino Ratio calculated on trade returns relative to **downside** standard deviation)
* `SortinoHyperOptLossDaily` (optimizes Sortino Ratio calculated on **daily** trade returns relative to **downside** standard deviation)
* `ShortTradeDurHyperOptLoss` - (default legacy Freqtrade hyperoptimization loss function) - Mostly for short trade duration and avoiding losses.
* `OnlyProfitHyperOptLoss` - takes only amount of profit into consideration.
* `SharpeHyperOptLoss` - optimizes Sharpe Ratio calculated on trade returns relative to standard deviation.
* `SharpeHyperOptLossDaily` - optimizes Sharpe Ratio calculated on **daily** trade returns relative to standard deviation.
* `SortinoHyperOptLoss` - optimizes Sortino Ratio calculated on trade returns relative to **downside** standard deviation.
* `SortinoHyperOptLossDaily` - optimizes Sortino Ratio calculated on **daily** trade returns relative to **downside** standard deviation.
* `MaxDrawDownHyperOptLoss` - Optimizes Maximum absolute drawdown.
* `MaxDrawDownRelativeHyperOptLoss` - Optimizes both maximum absolute drawdown while also adjusting for maximum relative drawdown.
* `CalmarHyperOptLoss` - Optimizes Calmar Ratio calculated on trade returns relative to max drawdown.
* `ProfitDrawDownHyperOptLoss` - Optimizes by max Profit & min Drawdown objective. `DRAWDOWN_MULT` variable within the hyperoptloss file can be adjusted to be stricter or more flexible on drawdown purposes.
Creation of a custom loss function is covered in the [Advanced Hyperopt](advanced-hyperopt.md) part of the documentation.
@@ -460,7 +631,7 @@ For example, to use one month of data, pass `--timerange 20210101-20210201` (fro
* `roi`: just optimize the minimal profit table for your strategy
* `stoploss`: search for the best stoploss value
* `trailing`: search for the best trailing stop values
* `default`: `all` except `trailing`
* `trades`: search for the best max open trades values
* `protection`: search for the best protection parameters (read the [protections section](#optimizing-protections) on how to properly define these)
* `default`: `all` except `trailing` and `protection`
* space-separated list of any of the above values for example `--spaces roi stoploss`
The default Hyperopt Search Space, used when no `--space` command line option is specified, does not include the `trailing` hyperspace. We recommend you to run optimization for the `trailing` hyperspace separately, when the best parameters for other hyperspaces were found, validated and pasted into your custom strategy.
@@ -509,7 +682,13 @@ You should understand this result like:
* You should not use ADX because `'buy_adx_enabled': False`.
* You should **consider** using the RSI indicator (`'buy_rsi_enabled': True`) and the best value is `29.0` (`'buy_rsi': 29.0`)
Your strategy class can immediately take advantage of these results. Simply copy hyperopt results block and paste them at class level, replacing old parameters (if any). New parameters will automatically be loaded next time strategy is executed.
### Automatic parameter application to the strategy
When using Hyperoptable parameters, the result of your hyperopt-run will be written to a json file next to your strategy (so for `MyAwesomeStrategy.py`, the file would be `MyAwesomeStrategy.json`).
This file is also updated when using the `hyperopt-show` sub-command, unless `--disable-param-export` is provided to either of the 2 commands.
Your strategy class can also contain these results explicitly. Simply copy hyperopt results block and paste them at class level, replacing old parameters (if any). New parameters will automatically be loaded next time strategy is executed.
Transferring your whole hyperopt result to your strategy would then look like:
@@ -525,6 +704,10 @@ class MyAwesomeStrategy(IStrategy):
}
```
!!! Note
Values in the configuration file will overwrite Parameter-file level parameters - and both will overwrite parameters within the strategy.
The prevalence is therefore: config > parameter file > strategy `*_params` > parameter default
### Understand Hyperopt ROI results
If you are optimizing ROI (i.e. if optimization search-space contains 'all', 'default' or 'roi'), your result will look as follows and include a ROI table:
@@ -571,11 +754,11 @@ If you are optimizing ROI, Freqtrade creates the 'roi' optimization hyperspace f
These ranges should be sufficient in most cases. The minutes in the steps (ROI dict keys) are scaled linearly depending on the timeframe used. The ROI values in the steps (ROI dict values) are scaled logarithmically depending on the timeframe used.
If you have the `generate_roi_table()` and `roi_space()` methods in your custom hyperopt file, remove them in order to utilize these adaptive ROI tables and the ROI hyperoptimization space generated by Freqtrade by default.
If you have the `generate_roi_table()` and `roi_space()` methods in your custom hyperopt, remove them in order to utilize these adaptive ROI tables and the ROI hyperoptimization space generated by Freqtrade by default.
Override the `roi_space()` method if you need components of the ROI tables to vary in other ranges. Override the `generate_roi_table()` and `roi_space()` methods and implement your own custom approach for generation of the ROI tables during hyperoptimization if you need a different structure of the ROI tables or other amount of rows (steps).
A sample for these methods can be found in [sample_hyperopt_advanced.py](https://github.com/freqtrade/freqtrade/blob/develop/freqtrade/templates/sample_hyperopt_advanced.py).
A sample for these methods can be found in the [overriding pre-defined spaces section](advanced-hyperopt.md#overriding-pre-defined-spaces).
!!! Note "Reduced search space"
To limit the search space further, Decimals are limited to 3 decimal places (a precision of 0.001). This is usually sufficient, every value more precise than this will usually result in overfitted results. You can however [overriding pre-defined spaces](advanced-hyperopt.md#pverriding-pre-defined-spaces) to change this to your needs.
@@ -617,7 +800,7 @@ If you are optimizing stoploss values, Freqtrade creates the 'stoploss' optimiza
If you have the `stoploss_space()` method in your custom hyperopt file, remove it in order to utilize Stoploss hyperoptimization space generated by Freqtrade by default.
Override the `stoploss_space()` method and define the desired range in it if you need stoploss values to vary in other range during hyperoptimization. A sample for this method can be found in [user_data/hyperopts/sample_hyperopt_advanced.py](https://github.com/freqtrade/freqtrade/blob/develop/freqtrade/templates/sample_hyperopt_advanced.py).
Override the `stoploss_space()` method and define the desired range in it if you need stoploss values to vary in other range during hyperoptimization. A sample for this method can be found in the [overriding pre-defined spaces section](advanced-hyperopt.md#overriding-pre-defined-spaces).
!!! Note "Reduced search space"
To limit the search space further, Decimals are limited to 3 decimal places (a precision of 0.001). This is usually sufficient, every value more precise than this will usually result in overfitted results. You can however [overriding pre-defined spaces](advanced-hyperopt.md#pverriding-pre-defined-spaces) to change this to your needs.
@@ -655,10 +838,10 @@ As stated in the comment, you can also use it as the values of the corresponding
If you are optimizing trailing stop values, Freqtrade creates the 'trailing' optimization hyperspace for you. By default, the `trailing_stop` parameter is always set to True in that hyperspace, the value of the `trailing_only_offset_is_reached` vary between True and False, the values of the `trailing_stop_positive` and `trailing_stop_positive_offset` parameters vary in the ranges 0.02...0.35 and 0.01...0.1 correspondingly, which is sufficient in most cases.
Override the `trailing_space()` method and define the desired range in it if you need values of the trailing stop parameters to vary in other ranges during hyperoptimization. A sample for this method can be found in [user_data/hyperopts/sample_hyperopt_advanced.py](https://github.com/freqtrade/freqtrade/blob/develop/freqtrade/templates/sample_hyperopt_advanced.py).
Override the `trailing_space()` method and define the desired range in it if you need values of the trailing stop parameters to vary in other ranges during hyperoptimization. A sample for this method can be found in the [overriding pre-defined spaces section](advanced-hyperopt.md#overriding-pre-defined-spaces).
!!! Note "Reduced search space"
To limit the search space further, Decimals are limited to 3 decimal places (a precision of 0.001). This is usually sufficient, every value more precise than this will usually result in overfitted results. You can however [overriding pre-defined spaces](advanced-hyperopt.md#pverriding-pre-defined-spaces) to change this to your needs.
To limit the search space further, Decimals are limited to 3 decimal places (a precision of 0.001). This is usually sufficient, every value more precise than this will usually result in overfitted results. You can however [overriding pre-defined spaces](advanced-hyperopt.md#overriding-pre-defined-spaces) to change this to your needs.
### Reproducible results
@@ -705,10 +888,29 @@ You can also enable position stacking in the configuration file by explicitly se
As hyperopt consumes a lot of memory (the complete data needs to be in memory once per parallel backtesting process), it's likely that you run into "out of memory" errors.
To combat these, you have multiple options:
* reduce the amount of pairs
* reduce the timerange used (`--timerange <timerange>`)
* reduce the number of parallel processes (`-j <n>`)
* Increase the memory of your machine
* Reduce the amount of pairs.
* Reduce the timerange used (`--timerange <timerange>`).
* Avoid using `--timeframe-detail` (this loads a lot of additional data into memory).
* Reduce the number of parallel processes (`-j <n>`).
* Increase the memory of your machine.
* Use `--analyze-per-epoch` if you're using a lot of parameters with `.range` functionality.
## The objective has been evaluated at this point before.
If you see `The objective has been evaluated at this point before.` - then this is a sign that your space has been exhausted, or is close to that.
Basically all points in your space have been hit (or a local minima has been hit) - and hyperopt does no longer find points in the multi-dimensional space it did not try yet.
Freqtrade tries to counter the "local minima" problem by using new, randomized points in this case.
The `buy_ema_short` space has 15 possible values (`5, 6, ... 19, 20`). If you now run hyperopt for the buy space, hyperopt will only have 15 values to try before running out of options.
Your epochs should therefore be aligned to the possible values - or you should be ready to interrupt a run if you norice a lot of `The objective has been evaluated at this point before.` warnings.
## Show details of Hyperopt results
@@ -718,8 +920,8 @@ After you run Hyperopt for the desired amount of epochs, you can later list all
Once the optimized strategy has been implemented into your strategy, you should backtest this strategy to make sure everything is working as expected.
To achieve same results (number of trades, their durations, profit, etc.) than during Hyperopt, please use same configuration and parameters (timerange, timeframe, ...) used for hyperopt `--dmmp`/`--disable-max-market-positions` and `--eps`/`--enable-position-stacking` for Backtesting.
To achieve same the results (number of trades, their durations, profit, etc.) as during Hyperopt, please use the same configuration and parameters (timerange, timeframe, ...) used for hyperopt `--dmmp`/`--disable-max-market-positions` and `--eps`/`--enable-position-stacking` for Backtesting.
Should results don't match, please double-check to make sure you transferred all conditions correctly.
Pay special care to the stoploss (and trailing stoploss) parameters, as these are often set in configuration files, which override changes to the strategy.
You should also carefully review the log of your backtest to ensure that there were no parameters inadvertently set by the configuration (like `stoploss` or `trailing_stop`).
Should results not match, please double-check to make sure you transferred all conditions correctly.
Pay special care to the stoploss, max_open_trades and trailing stoploss parameters, as these are often set in configuration files, which override changes to the strategy.
You should also carefully review the log of your backtest to ensure that there were no parameters inadvertently set by the configuration (like `stoploss`, `max_open_trades` or `trailing_stop`).
@@ -22,7 +22,10 @@ You may also use something like `.*DOWN/BTC` or `.*UP/BTC` to exclude leveraged
* [`StaticPairList`](#static-pair-list) (default, if not configured differently)
* [`VolumePairList`](#volume-pair-list)
* [`ProducerPairList`](#producerpairlist)
* [`RemotePairList`](#remotepairlist)
* [`AgeFilter`](#agefilter)
* [`OffsetFilter`](#offsetfilter)
* [`PerformanceFilter`](#performancefilter)
* [`PrecisionFilter`](#precisionfilter)
* [`PriceFilter`](#pricefilter)
@@ -43,7 +46,7 @@ It uses configuration from `exchange.pair_whitelist` and `exchange.pair_blacklis
```json
"pairlists":[
{"method":"StaticPairList"}
],
],
```
By default, only currently enabled pairs are allowed.
@@ -51,43 +54,214 @@ To skip pair validation against active markets, set `"allow_inactive": true` wit
This can be useful for backtesting expired pairs (like quarterly spot-markets).
This option must be configured along with `exchange.skip_pair_validation` in the exchange configuration.
When used in a "follow-up" position (e.g. after VolumePairlist), all pairs in `'pair_whitelist'` will be added to the end of the pairlist.
#### Volume Pair List
`VolumePairList` employs sorting/filtering of pairs by their trading volume. It selects `number_assets` top pairs with sorting based on the `sort_key` (which can only be `quoteVolume`).
When used in the chain of Pairlist Handlers in a non-leading position (after StaticPairList and other Pairlist Filters), `VolumePairList` considers outputs of previous Pairlist Handlers, adding its sorting/selection of the pairs by the trading volume.
When used on the leading position of the chain of Pairlist Handlers, it does not consider`pair_whitelist` configuration setting, but selects the top assets from all available markets (with matching stake-currency) on the exchange.
When used in the leading position of the chain of Pairlist Handlers, the`pair_whitelist` configuration setting is ignored. Instead, `VolumePairList` selects the top assets from all available markets with matching stake-currency on the exchange.
The `refresh_period` setting allows to define the period (in seconds), at which the pairlist will be refreshed. Defaults to 1800s (30 minutes).
The pairlist cache (`refresh_period`) on `VolumePairList` is only applicable to generating pairlists.
Filtering instances (not the first position in the list) will not apply any cache and will always use up-to-date data.
`VolumePairList` is based on the ticker data from exchange, as reported by the ccxt library:
`VolumePairList` is per default based on the ticker data from exchange, as reported by the ccxt library:
* The `quoteVolume` is the amount of quote (stake) currency traded (bought or sold) in last 24 hours.
```json
"pairlists":[{
"pairlists":[
{
"method":"VolumePairList",
"number_assets":20,
"sort_key":"quoteVolume",
"min_value":0,
"refresh_period":1800
}],
}
],
```
You can define a minimum volume with `min_value` - which will filter out pairs with a volume lower than the specified value in the specified timerange.
##### VolumePairList Advanced mode
`VolumePairList` can also operate in an advanced mode to build volume over a given timerange of specified candle size. It utilizes exchange historical candle data, builds a typical price (calculated by (open+high+low)/3) and multiplies the typical price with every candle's volume. The sum is the `quoteVolume` over the given range. This allows different scenarios, for a more smoothened volume, when using longer ranges with larger candle sizes, or the opposite when using a short range with small candles.
For convenience `lookback_days` can be specified, which will imply that 1d candles will be used for the lookback. In the example below the pairlist would be created based on the last 7 days:
```json
"pairlists":[
{
"method":"VolumePairList",
"number_assets":20,
"sort_key":"quoteVolume",
"min_value":0,
"refresh_period":86400,
"lookback_days":7
}
],
```
!!! Warning "Range look back and refresh period"
When used in conjunction with `lookback_days` and `lookback_timeframe` the `refresh_period` can not be smaller than the candle size in seconds. As this will result in unnecessary requests to the exchanges API.
!!! Warning "Performance implications when using lookback range"
If used in first position in combination with lookback, the computation of the range based volume can be time and resource consuming, as it downloads candles for all tradable pairs. Hence it's highly advised to use the standard approach with `VolumeFilter` to narrow the pairlist down for further range volume calculation.
??? Tip "Unsupported exchanges (Bittrex, Gemini)"
On some exchanges (like Bittrex and Gemini), regular VolumePairList does not work as the api does not natively provide 24h volume. This can be worked around by using candle data to build the volume.
To roughly simulate 24h volume, you can use the following configuration.
Please note that These pairlists will only refresh once per day.
```json
"pairlists": [
{
"method": "VolumePairList",
"number_assets": 20,
"sort_key": "quoteVolume",
"min_value": 0,
"refresh_period": 86400,
"lookback_days": 1
}
],
```
More sophisticated approach can be used, by using `lookback_timeframe` for candle size and `lookback_period` which specifies the amount of candles. This example will build the volume pairs based on a rolling period of 3 days of 1h candles:
```json
"pairlists": [
{
"method": "VolumePairList",
"number_assets": 20,
"sort_key": "quoteVolume",
"min_value": 0,
"refresh_period": 3600,
"lookback_timeframe": "1h",
"lookback_period": 72
}
],
```
!!! Note
`VolumePairList` does not support backtesting mode.
#### ProducerPairList
With `ProducerPairList`, you can reuse the pairlist from a [Producer](producer-consumer.md) without explicitly defining the pairlist on each consumer.
[Consumer mode](producer-consumer.md) is required for this pairlist to work.
The pairlist will perform a check on active pairs against the current exchange configuration to avoid attempting to trade on invalid markets.
You can limit the length of the pairlist with the optional parameter `number_assets`. Using `"number_assets"=0` or omitting this key will result in the reuse of all producer pairs valid for the current setup.
```json
"pairlists": [
{
"method": "ProducerPairList",
"number_assets": 5,
"producer_name": "default",
}
],
```
!!! Tip "Combining pairlists"
This pairlist can be combined with all other pairlists and filters for further pairlist reduction, and can also act as an "additional" pairlist, on top of already defined pairs.
`ProducerPairList` can also be used multiple times in sequence, combining the pairs from multiple producers.
Obviously in complex such configurations, the Producer may not provide data for all pairs, so the strategy must be fit for this.
#### RemotePairList
It allows the user to fetch a pairlist from a remote server or a locally stored json file within the freqtrade directory, enabling dynamic updates and customization of the trading pairlist.
The RemotePairList is defined in the pairlists section of the configuration settings. It uses the following configuration options:
```json
"pairlists": [
{
"method": "RemotePairList",
"mode": "whitelist",
"processing_mode": "filter",
"pairlist_url": "https://example.com/pairlist",
"number_assets": 10,
"refresh_period": 1800,
"keep_pairlist_on_failure": true,
"read_timeout": 60,
"bearer_token": "my-bearer-token"
}
]
```
The optional `mode` option specifies if the pairlist should be used as a `blacklist` or as a `whitelist`. The default value is "whitelist".
The optional `processing_mode` option in the RemotePairList configuration determines how the retrieved pairlist is processed. It can have two values: "filter" or "append".
In "filter" mode, the retrieved pairlist is used as a filter. Only the pairs present in both the original pairlist and the retrieved pairlist are included in the final pairlist. Other pairs are filtered out.
In "append" mode, the retrieved pairlist is added to the original pairlist. All pairs from both lists are included in the final pairlist without any filtering.
The `pairlist_url` option specifies the URL of the remote server where the pairlist is located, or the path to a local file (if file:/// is prepended). This allows the user to use either a remote server or a local file as the source for the pairlist.
The user is responsible for providing a server or local file that returns a JSON object with the following structure:
```json
{
"pairs": ["XRP/USDT", "ETH/USDT", "LTC/USDT"],
"refresh_period": 1800
}
```
The `pairs` property should contain a list of strings with the trading pairs to be used by the bot. The `refresh_period` property is optional and specifies the number of seconds that the pairlist should be cached before being refreshed.
The optional `keep_pairlist_on_failure` specifies whether the previous received pairlist should be used if the remote server is not reachable or returns an error. The default value is true.
The optional `read_timeout` specifies the maximum amount of time (in seconds) to wait for a response from the remote source, The default value is 60.
The optional `bearer_token` will be included in the requests Authorization Header.
!!! Note
In case of a server error the last received pairlist will be kept if `keep_pairlist_on_failure` is set to true, when set to false a empty pairlist is returned.
#### AgeFilter
Removes pairs that have been listed on the exchange for less than `min_days_listed` days (defaults to `10`).
Removes pairs that have been listed on the exchange for less than `min_days_listed` days (defaults to `10`) or more than `max_days_listed` days (defaults `None` mean infinity).
When pairs are first listed on an exchange they can suffer huge price drops and volatility
in the first few days while the pair goes through its price-discovery period. Bots can often
be caught out buying before the pair has finished dropping in price.
This filter allows freqtrade to ignore pairs until they have been listed for at least `min_days_listed` days.
This filter allows freqtrade to ignore pairs until they have been listed for at least `min_days_listed` days and listed before `max_days_listed`.
#### OffsetFilter
Offsets an incoming pairlist by a given `offset` value.
As an example it can be used in conjunction with `VolumeFilter` to remove the top X volume pairs. Or to split a larger pairlist on two bot instances.
Example to remove the first 10 pairs from the pairlist, and takes the next 20 (taking items 10-30 of the initial list):
```json
"pairlists": [
// ...
{
"method": "OffsetFilter",
"offset": 10,
"number_assets": 20
}
],
```
!!! Warning
When `OffsetFilter` is used to split a larger pairlist among multiple bots in combination with `VolumeFilter`
it can not be guaranteed that pairs won't overlap due to slightly different refresh intervals for the
`VolumeFilter`.
!!! Note
An offset larger than the total length of the incoming pairlist will result in an empty pairlist.
#### PerformanceFilter
@@ -99,13 +273,36 @@ Sorts pairs by past trade performance, as follows:
Trade count is used as a tie breaker.
!!! Note
You can use the `minutes` parameter to only consider performance of the past X minutes (rolling window).
Not defining this parameter (or setting it to 0) will use all-time performance.
The optional `min_profit` (as ratio -> a setting of `0.01` corresponds to 1%) parameter defines the minimum profit a pair must have to be considered.
Pairs below this level will be filtered out.
Using this parameter without `minutes` is highly discouraged, as it can lead to an empty pairlist without a way to recover.
```json
"pairlists": [
// ...
{
"method": "PerformanceFilter",
"minutes": 1440, // rolling 24h
"min_profit": 0.01 // minimal profit 1%
}
],
```
As this Filter uses past performance of the bot, it'll have some startup-period - and should only be used after the bot has a few 100 trades in the database.
!!! Warning "Backtesting"
`PerformanceFilter` does not support backtesting mode.
#### PrecisionFilter
Filters low-value coins which would not allow setting stoplosses.
!!! Warning "Backtesting"
`PrecisionFilter` does not support backtesting mode using multiple strategies.
#### PriceFilter
The `PriceFilter` allows filtering of pairs by price. Currently the following price filters are supported:
@@ -124,12 +321,12 @@ This option is disabled by default, and will only apply if set to > 0.
The `max_value` setting removes pairs where the minimum value change is above a specified value.
This is useful when an exchange has unbalanced limits. For example, if step-size = 1 (so you can only buy 1, or 2, or 3, but not 1.1 Coins) - and the price is pretty high (like 20\$) as the coin has risen sharply since the last limit adaption.
As a result of the above, you can only buy for 20\$, or 40\$ - but not for 25\$.
On exchanges that deduct fees from the receiving currency (e.g. FTX) - this can result in high value coins / amounts that are unsellable as the amount is slightly below the limit.
On exchanges that deduct fees from the receiving currency (e.g. binance) - this can result in high value coins / amounts that are unsellable as the amount is slightly below the limit.
The `low_price_ratio` setting removes pairs where a raise of 1 price unit (pip) is above the `low_price_ratio` ratio.
This option is disabled by default, and will only apply if set to > 0.
For `PriceFiler` at least one of its `min_price`, `max_price` or `low_price_ratio` settings must be applied.
For `PriceFilter` at least one of its `min_price`, `max_price` or `low_price_ratio` settings must be applied.
Calculation example:
@@ -142,8 +339,20 @@ Min price precision for SHITCOIN/BTC is 8 decimals. If its price is 0.00000011 -
Shuffles (randomizes) pairs in the pairlist. It can be used for preventing the bot from trading some of the pairs more frequently then others when you want all pairs be treated with the same priority.
By default, ShuffleFilter will shuffle pairs once per candle.
To shuffle on every iteration, set `"shuffle_frequency"` to `"iteration"` instead of the default of `"candle"`.
``` json
{
"method": "ShuffleFilter",
"shuffle_frequency": "candle",
"seed": 42
}
```
!!! Tip
You may set the `seed` value for this Pairlist to obtain reproducible results, which can be useful for repeated backtesting sessions. If `seed` is not set, the pairs are shuffled in the non-repeatable random order.
You may set the `seed` value for this Pairlist to obtain reproducible results, which can be useful for repeated backtesting sessions. If `seed` is not set, the pairs are shuffled in the non-repeatable random order. ShuffleFilter will automatically detect runmodes and apply the `seed` only for backtesting modes - if a `seed` value is set.
#### SpreadFilter
@@ -155,10 +364,10 @@ If `DOGE/BTC` maximum bid is 0.00000026 and minimum ask is 0.00000027, the ratio
#### RangeStabilityFilter
Removes pairs where the difference between lowest low and highest high over `lookback_days` days is below `min_rate_of_change`. Since this is a filter that requires additional data, the results are cached for `refresh_period`.
Removes pairs where the difference between lowest low and highest high over `lookback_days` days is below `min_rate_of_change` or above `max_rate_of_change`. Since this is a filter that requires additional data, the results are cached for `refresh_period`.
In the below example:
If the trading range over the last 10 days is <1%,removethe pair from the whitelist.
If the trading range over the last 10 days is <1% or >99%, remove the pairfrom the whitelist.
```json
"pairlists": [
@@ -166,6 +375,7 @@ If the trading range over the last 10 days is <1%, remove the pair from the whit
"method": "RangeStabilityFilter",
"lookback_days": 10,
"min_rate_of_change": 0.01,
"max_rate_of_change": 0.99,
"refresh_period": 1440
}
]
@@ -173,10 +383,11 @@ If the trading range over the last 10 days is <1%, remove the pair from the whit
!!! Tip
This Filter can be used to automatically remove stable coin pairs, which have a very low trading range, and are therefore extremely difficult to trade with profit.
Additionally, it can also be used to automatically remove pairs with extreme high/low variance over a given amount of time.
#### VolatilityFilter
Volatility isthedegreeof historical variation ofa pairs over time,isismeasuredbythe standard deviation of logarithmic daily returns. Returns areassumedtobe normally distributed, although actual distribution might be different.Ina normal distribution,68%of observations fall within one standard deviation and95%of observations fall within two standard deviations. Assuming a volatility of0.05 means that the expected returns for20outof30daysisexpectedtobe less than 5%(one standard deviation). Volatility isa positive ratio ofthe expected deviation ofreturnandcanbe greater than 1.00. Please refer tothe wikipedia definition of [`volatility`](https://en.wikipedia.org/wiki/Volatility_(finance)).
Volatility is the degree of historicalvariation of a pairsovertime, it is measured by the standarddeviation of logarithmicdailyreturns. Returns are assumed to be normallydistributed, althoughactualdistributionmight be different. In a normaldistribution, 68% of observationsfallwithin one standarddeviation and 95% of observationsfallwithin two standarddeviations. Assuming a volatility of 0.05 meansthat the expectedreturns for 20 out of 30 days is expected to be lessthan 5% (one standarddeviation). Volatility is a positiveratio of the expecteddeviation of return and can be greaterthan 1.00. Pleaserefer to the wikipediadefinitionof [`volatility`](https://en.wikipedia.org/wiki/Volatility_(finance)).
This filter removes pairs if the average volatility over a `lookback_days` days is below `min_volatility` or above `max_volatility`. Since this is a filter that requires additional data, the results are cached for `refresh_period`.
@@ -230,5 +441,5 @@ The below example blacklists `BNB/BTC`, uses `VolumePairList` with `20` assets,
Prices for regular orders can be controlled via the parameter structures `bid_strategy` for buying and `ask_strategy` for selling.
Prices for regular orders can be controlled via the parameter structures `entry_pricing` for trade entries and `exit_pricing` for trade exits.
Prices are always retrieved right before an order is placed, either by querying the exchange tickers or by using the orderbook data.
!!! Note
@@ -9,20 +9,11 @@ Prices are always retrieved right before an order is placed, either by querying
!!! Warning "Using market orders"
Please read the section [Market order pricing](#market-order-pricing) section when using market orders.
### Buy price
### Entry price
#### Check depth of market
#### Enter price side
When check depth of market is enabled (`bid_strategy.check_depth_of_market.enabled=True`), the buy signals are filtered based on the orderbook depth (sum of all amounts) for each orderbook side.
Orderbook `bid` (buy) side depth is then divided by the orderbook `ask` (sell) side depth and the resulting delta is compared to the value of the `bid_strategy.check_depth_of_market.bids_to_ask_delta` parameter. The buy order is only executed if the orderbook delta is greater than or equal to the configured delta value.
!!! Note
A delta value below 1 means that `ask` (sell) orderbook side depth is greater than the depth of the `bid` (buy) orderbook side, while a value greater than 1 means opposite (depth of the buy side is higher than the depth of the sell side).
#### Buy price side
The configuration setting `bid_strategy.price_side` defines the side of the spread the bot looks for when buying.
The configuration setting `entry_pricing.price_side` defines the side of the orderbook the bot looks for when buying.
The following displays an orderbook.
@@ -38,30 +29,53 @@ The following displays an orderbook.
...
```
If `bid_strategy.price_side` is set to `"bid"`, then the bot will use 99 as buying price.
In line with that, if `bid_strategy.price_side` is set to `"ask"`, then the bot will use 101 as buying price.
If `entry_pricing.price_side` is set to `"bid"`, then the bot will use 99 as entry price.
In line with that, if `entry_pricing.price_side` is set to `"ask"`, then the bot will use 101 as entry price.
Using `ask` price often guarantees quicker filled orders, but the bot can also end up paying more than what would have been necessary.
Depending on the order direction (_long_/_short_), this will lead to different results. Therefore we recommend to use `"same"` or `"other"` for this configuration instead.
This would result in the following pricing matrix:
| direction | Order | setting | price | crosses spread |
|------ |--------|-----|-----|-----|
| long | buy | ask | 101 | yes |
| long | buy | bid | 99 | no |
| long | buy | same | 99 | no |
| long | buy | other | 101 | yes |
| short | sell | ask | 101 | no |
| short | sell | bid | 99 | yes |
| short | sell | same | 101 | no |
| short | sell | other | 99 | yes |
Using the other side of the orderbook often guarantees quicker filled orders, but the bot can also end up paying more than what would have been necessary.
Taker fees instead of maker fees will most likely apply even when using limit buy orders.
Also, prices at the "ask" side of the spread are higher than prices at the "bid" side in the orderbook, so the order behaves similar to a market order (however with a maximum price).
Also, prices at the "other" side of the spread are higher than prices at the "bid" side in the orderbook, so the order behaves similar to a market order (however with a maximum price).
#### Buy price with Orderbook enabled
#### Entry price with Orderbook enabled
When buying with the orderbook enabled (`bid_strategy.use_order_book=True`), Freqtrade fetches the `bid_strategy.order_book_top` entries from the orderbook and then uses the entry specified as `bid_strategy.order_book_top` on the configured side (`bid_strategy.price_side`) of the orderbook. 1 specifies the topmost entry in the orderbook, while 2 would use the 2nd entry in the orderbook, and so on.
When entering a trade with the orderbook enabled (`entry_pricing.use_order_book=True`), Freqtrade fetches the `entry_pricing.order_book_top` entries from the orderbook and uses the entry specified as `entry_pricing.order_book_top` on the configured side (`entry_pricing.price_side`) of the orderbook. 1 specifies the topmost entry in the orderbook, while 2 would use the 2nd entry in the orderbook, and so on.
#### Buy price without Orderbook enabled
#### Entry price without Orderbook enabled
The following section uses `side` as the configured `bid_strategy.price_side`.
The following section uses `side` as the configured `entry_pricing.price_side` (defaults to `"same"`).
When not using orderbook (`bid_strategy.use_order_book=False`), Freqtrade uses the best `side` price from the ticker if it's below the `last` traded price from the ticker. Otherwise (when the `side` price is above the `last` price), it calculates a rate between `side` and `last` price.
When not using orderbook (`entry_pricing.use_order_book=False`), Freqtrade uses the best `side` price from the ticker if it's below the `last` traded price from the ticker. Otherwise (when the `side` price is above the `last` price), it calculates a rate between `side` and `last` price based on `entry_pricing.price_last_balance`.
The `bid_strategy.ask_last_balance` configuration parameter controls this. A value of `0.0` will use `side` price, while `1.0` will use the `last` price and values between those interpolate between ask and last price.
The `entry_pricing.price_last_balance` configuration parameter controls this. A value of `0.0` will use `side` price, while `1.0` will use the `last` price and values between those interpolate between ask and last price.
### Sell price
#### Check depth of market
#### Sell price side
When check depth of market is enabled (`entry_pricing.check_depth_of_market.enabled=True`), the entry signals are filtered based on the orderbook depth (sum of all amounts) for each orderbook side.
The configuration setting `ask_strategy.price_side` defines the side of the spread the bot looks for when selling.
Orderbook `bid` (buy) side depth is then divided by the orderbook `ask` (sell) side depth and the resulting delta is compared to the value of the `entry_pricing.check_depth_of_market.bids_to_ask_delta` parameter. The entry order is only executed if the orderbook delta is greater than or equal to the configured delta value.
!!! Note
A delta value below 1 means that `ask` (sell) orderbook side depth is greater than the depth of the `bid` (buy) orderbook side, while a value greater than 1 means opposite (depth of the buy side is higher than the depth of the sell side).
### Exit price
#### Exit price side
The configuration setting `exit_pricing.price_side` defines the side of the spread the bot looks for when exiting a trade.
The following displays an orderbook:
@@ -77,53 +91,54 @@ The following displays an orderbook:
...
```
If `ask_strategy.price_side` is set to `"ask"`, then the bot will use 101 as selling price.
In line with that, if `ask_strategy.price_side` is set to `"bid"`, then the bot will use 99 as selling price.
If `exit_pricing.price_side` is set to `"ask"`, then the bot will use 101 as exiting price.
In line with that, if `exit_pricing.price_side` is set to `"bid"`, then the bot will use 99 as exiting price.
#### Sell price with Orderbook enabled
Depending on the order direction (_long_/_short_), this will lead to different results. Therefore we recommend to use `"same"` or `"other"` for this configuration instead.
This would result in the following pricing matrix:
When selling with the orderbook enabled (`ask_strategy.use_order_book=True`), Freqtrade fetches the `ask_strategy.order_book_max` entries in the orderbook. Then each of the orderbook steps between `ask_strategy.order_book_min` and `ask_strategy.order_book_max` on the configured orderbook side are validated for a profitable sell-possibility based on the strategy configuration (`minimal_roi` conditions) and the sell order is placed at the first profitable spot.
| Direction | Order | setting | price | crosses spread |
|------ |--------|-----|-----|-----|
| long | sell | ask | 101 | no |
| long | sell | bid | 99 | yes |
| long | sell | same | 101 | no |
| long | sell | other | 99 | yes |
| short | buy | ask | 101 | yes |
| short | buy | bid | 99 | no |
| short | buy | same | 99 | no |
| short | buy | other | 101 | yes |
!!! Note
Using `order_book_max` higher than `order_book_min` only makes sense when ask_strategy.price_side is set to `"ask"`.
#### Exit price with Orderbook enabled
The idea here is to place the sell order early, to be ahead in the queue.
When exiting with the orderbook enabled (`exit_pricing.use_order_book=True`), Freqtrade fetches the `exit_pricing.order_book_top` entries in the orderbook and uses the entry specified as `exit_pricing.order_book_top` from the configured side (`exit_pricing.price_side`) as trade exit price.
A fixed slot (mirroring `bid_strategy.order_book_top`) can be defined by setting `ask_strategy.order_book_min` and `ask_strategy.order_book_max` to the same number.
1 specifies the topmost entry in the orderbook, while 2 would use the 2nd entry in the orderbook, and so on.
!!! Warning "Order_book_max > 1 - increased risks for stoplosses!"
Using `ask_strategy.order_book_max` higher than 1 will increase the risk the stoploss on exchange is cancelled too early, since an eventual [stoploss on exchange](#understand-order_types) will be cancelled as soon as the order is placed.
Also, the sell order will remain on the exchange for `unfilledtimeout.sell` (or until it's filled) - which can lead to missed stoplosses (with or without using stoploss on exchange).
#### Exit price without Orderbook enabled
!!! Warning "Order_book_max > 1 in dry-run"
Using `ask_strategy.order_book_max` higher than 1 will result in improper dry-run results (significantly better than real orders executed on exchange), since dry-run assumes orders to be filled almost instantly.
It is therefore advised to not use this setting for dry-runs.
The following section uses `side` as the configured `exit_pricing.price_side` (defaults to `"ask"`).
#### Sell price without Orderbook enabled
When not using orderbook (`exit_pricing.use_order_book=False`), Freqtrade uses the best `side` price from the ticker if it's above the `last` traded price from the ticker. Otherwise (when the `side` price is below the `last` price), it calculates a rate between `side` and `last` price based on `exit_pricing.price_last_balance`.
When not using orderbook (`ask_strategy.use_order_book=False`), the price at the `ask_strategy.price_side` side (defaults to `"ask"`) from the ticker will be used as the sell price.
When not using orderbook (`ask_strategy.use_order_book=False`), Freqtrade uses the best `side` price from the ticker if it's below the `last` traded price from the ticker. Otherwise (when the `side` price is above the `last` price), it calculates a rate between `side` and `last` price.
The `ask_strategy.bid_last_balance` configuration parameter controls this. A value of `0.0` will use `side` price, while `1.0` will use the last price and values between those interpolate between `side` and last price.
The `exit_pricing.price_last_balance` configuration parameter controls this. A value of `0.0` will use `side` price, while `1.0` will use the last price and values between those interpolate between `side` and last price.
### Market order pricing
When using market orders, prices should be configured to use the "correct" side of the orderbook to allow realistic pricing detection.
Assuming both buy and sell are using market orders, a configuration similar to the following might be used
Assuming both entry and exits are using market orders, a configuration similar to the following must be used
This feature is still in it's testing phase. Should you notice something you think is wrong please let us know via Discord, Slack or via Github Issue.
This feature is still in it's testing phase. Should you notice something you think is wrong please let us know via Discord or via Github Issue.
Protections will protect your strategy from unexpected events and market conditions by temporarily stop trading for either one pair, or for all pairs.
All protection end times are rounded up to the next candle to avoid sudden, unexpected intra-candle buys.
@@ -15,6 +15,10 @@ All protection end times are rounded up to the next candle to avoid sudden, unex
!!! Note "Backtesting"
Protections are supported by backtesting and hyperopt, but must be explicitly enabled by using the `--enable-protections` flag.
!!! Warning "Setting protections from the configuration"
Setting protections from the configuration via `"protections": [],` key should be considered deprecated and will be removed in a future version.
It is also no longer guaranteed that your protections apply to the strategy in cases where the strategy defines [protections as property](hyperopt.md#optimizing-protections).
### Available Protections
* [`StoplossGuard`](#stoploss-guard) Stop trading if a certain amount of stoploss occurred within a certain time window.
@@ -44,18 +48,26 @@ If `trade_limit` or more trades resulted in stoploss, trading will stop for `sto
This applies across all pairs, unless `only_per_pair` is set to true, which will then only look at one pair at a time.
Similarly, this protection will by default look at all trades (long and short). For futures bots, setting `only_per_side` will make the bot only consider one side, and will then only lock this one side, allowing for example shorts to continue after a series of long stoplosses.
`required_profit` will determine the required relative profit (or loss) for stoplosses to consider. This should normally not be set and defaults to 0.0 - which means all losing stoplosses will be triggering a block.
The below example stops trading for all pairs for 4 candles after the last trade if the bot hit stoploss 4 times within the last 24 candles.
``` python
protections = [
{
"method": "StoplossGuard",
"lookback_period_candles": 24,
"trade_limit": 4,
"stop_duration_candles": 4,
"only_per_pair": False
}
]
@property
def protections(self):
return [
{
"method": "StoplossGuard",
"lookback_period_candles": 24,
"trade_limit": 4,
"stop_duration_candles": 4,
"required_profit": 0.0,
"only_per_pair": False,
"only_per_side": False
}
]
```
!!! Note
@@ -69,15 +81,17 @@ protections = [
The below sample stops trading for 12 candles if max-drawdown is > 20% considering all pairs - with a minimum of `trade_limit` trades - within the last 48 candles. If desired, `lookback_period` and/or `stop_duration` can be used.
``` python
protections = [
{
"method": "MaxDrawdown",
"lookback_period_candles": 48,
"trade_limit": 20,
"stop_duration_candles": 12,
"max_allowed_drawdown": 0.2
},
]
@property
def protections(self):
return [
{
"method": "MaxDrawdown",
"lookback_period_candles": 48,
"trade_limit": 20,
"stop_duration_candles": 12,
"max_allowed_drawdown": 0.2
},
]
```
#### Low Profit Pairs
@@ -85,18 +99,23 @@ protections = [
`LowProfitPairs` uses all trades for a pair within `lookback_period` in minutes (or in candles when using `lookback_period_candles`) to determine the overall profit ratio.
If that ratio is below `required_profit`, that pair will be locked for `stop_duration` in minutes (or in candles when using `stop_duration_candles`).
For futures bots, setting `only_per_side` will make the bot only consider one side, and will then only lock this one side, allowing for example shorts to continue after a series of long losses.
The below example will stop trading a pair for 60 minutes if the pair does not have a required profit of 2% (and a minimum of 2 trades) within the last 6 candles.
``` python
protections = [
{
"method": "LowProfitPairs",
"lookback_period_candles": 6,
"trade_limit": 2,
"stop_duration": 60,
"required_profit": 0.02
}
]
@property
def protections(self):
return [
{
"method": "LowProfitPairs",
"lookback_period_candles": 6,
"trade_limit": 2,
"stop_duration": 60,
"required_profit": 0.02,
"only_per_pair": False,
}
]
```
#### Cooldown Period
@@ -106,12 +125,14 @@ protections = [
The below example will stop trading a pair for 2 candles after closing a trade, allowing this pair to "cool down".
``` python
protections = [
{
"method": "CooldownPeriod",
"stop_duration_candles": 2
}
]
@property
def protections(self):
return [
{
"method": "CooldownPeriod",
"stop_duration_candles": 2
}
]
```
!!! Note
@@ -128,7 +149,7 @@ The below example assumes a timeframe of 1 hour:
* Locks each pair after selling for an additional 5 candles (`CooldownPeriod`), giving other pairs a chance to get filled.
* Stops trading for 4 hours (`4 * 1h candles`) if the last 2 days (`48 * 1h candles`) had 20 trades, which caused a max-drawdown of more than 20%. (`MaxDrawdown`).
* Stops trading if more than 4 stoploss occur for all pairs within a 1 day (`24 * 1h candles`) limit (`StoplossGuard`).
* Locks all pairs that had 4 Trades within the last 6 hours (`6 * 1h candles`) with a combined profit ratio of below 0.02 (<2%) (`LowProfitPairs`).
* Locks all pairs that had 2 Trades within the last 6 hours (`6 * 1h candles`) with a combined profit ratio of below 0.02 (<2%) (`LowProfitPairs`).
* Locks all pairs for 2 candles that had a profit of below 0.01 (<1%) within the last 24h (`24 * 1h candles`), a minimum of 4 trades.
``` python
@@ -136,39 +157,42 @@ from freqtrade.strategy import IStrategy
Freqtrade is a crypto-currency algorithmic trading software developed in python (3.7+) and supported on Windows, macOS and Linux.
Freqtrade is a free and open source crypto trading bot written in Python. It is designed to support all major exchanges and be controlled via Telegram or webUI. It contains backtesting, plotting and money management tools as well as strategy optimization by machine learning.
!!! Danger "DISCLAIMER"
This software is for educational purposes only. Do not risk money which you are afraid to lose. USE THE SOFTWARE AT YOUR OWN RISK. THE AUTHORS AND ALL AFFILIATES ASSUME NO RESPONSIBILITY FOR YOUR TRADING RESULTS.
@@ -20,6 +21,8 @@ Freqtrade is a crypto-currency algorithmic trading software developed in python
We strongly recommend you to have basic coding skills and Python knowledge. Do not hesitate to read the source code and understand the mechanisms of this bot, algorithms and techniques implemented in it.
- Develop your Strategy: Write your strategy in python, using [pandas](https://pandas.pydata.org/). Example strategies to inspire you are available in the [strategy repository](https://github.com/freqtrade/freqtrade-strategies).
@@ -29,24 +32,40 @@ Freqtrade is a crypto-currency algorithmic trading software developed in python
- Select markets: Create your static list or use an automatic one based on top traded volumes and/or prices (not available during backtesting). You can also explicitly blacklist markets you don't want to trade.
- Run: Test your strategy with simulated money (Dry-Run mode) or deploy it with real money (Live-Trade mode).
- Run using Edge (optional module): The concept is to find the best historical [trade expectancy](edge.md#expectancy) by markets based on variation of the stop-loss and then allow/reject markets to trade. The sizing of the trade is based on a risk of a percentage of your capital.
- Control/Monitor: Use Telegram or a REST API (start/stop the bot, show profit/loss, daily summary, current open trades results, etc.).
- Analyse: Further analysis can be performed on either Backtesting data or Freqtrade trading history (SQL database), including automated standard plots, and methods to load the data into [interactive environments](data-analysis.md).
- Control/Monitor: Use Telegram or a WebUI (start/stop the bot, show profit/loss, daily summary, current open trades results, etc.).
- Analyze: Further analysis can be performed on either Backtesting data or Freqtrade trading history (SQL database), including automated standard plots, and methods to load the data into [interactive environments](data-analysis.md).
## Supported exchange marketplaces
Please read the [exchange specific notes](exchanges.md) to learn about eventual, special configurations needed for each exchange.
- [X] [Binance](https://www.binance.com/) ([*Note for binance users](exchanges.md#blacklists))
- [X] [Binance](https://www.binance.com/)
- [X] [Bittrex](https://bittrex.com/)
- [X] [FTX](https://ftx.com)
- [X] [Gate.io](https://www.gate.io/ref/6266643)
- [X] [Huobi](http://huobi.com/)
- [X] [Kraken](https://kraken.com/)
- [X] [OKX](https://okx.com/) (Former OKEX)
- [ ] [potentially many others through <img alt="ccxt" width="30px" src="assets/ccxt-logo.svg" />](https://github.com/ccxt/ccxt/). _(We cannot guarantee they will work)_
### Supported Futures Exchanges (experimental)
- [X] [Binance](https://www.binance.com/)
- [X] [Gate.io](https://www.gate.io/ref/6266643)
- [X] [OKX](https://okx.com/)
- [X] [Bybit](https://bybit.com/)
Please make sure to read the [exchange specific notes](exchanges.md), as well as the [trading with leverage](leverage.md) documentation before diving in.
### Community tested
Exchanges confirmed working by the community:
- [X] [Bitvavo](https://bitvavo.com/)
- [X] [Kucoin](https://www.kucoin.com/)
## Community showcase
--8<--"includes/showcase.md"
## Requirements
@@ -64,7 +83,7 @@ To run this bot we recommend you a linux cloud instance with a minimum of:
Alternatively
- Python 3.7+
-Python 3.8+
-pip(pip3)
-git
-TA-Lib
@@ -72,14 +91,10 @@ Alternatively
## Support
### Help / Discord / Slack
### Help / Discord
For any questions not covered by the documentation or for furtherinformationabout the bot, or to simplyengagewithlike-mindedindividuals, we encourage you to join our slack channel.
Please check out our [discord server](https://discord.gg/p7nuUNVfP7).
You can also join our [Slack channel](https://join.slack.com/t/highfrequencybot/shared_invite/zt-mm786y93-Fxo37glxMY9g8OQC5AoOIw).
For anyquestionsnotcoveredbythedocumentationorfor further information about thebot,orto simply engage with like-minded individuals,weencourageyoutojointheFreqtrade [discord server](https://discord.gg/p7nuUNVfP7).
## Ready to try?
Begin by reading our installationguide [for docker](docker_quickstart.md) (recommended), or for [installation without docker](installation.md).
Begin byreadingthe installation guide [for docker](docker_quickstart.md) (recommended),or for [installation without docker](installation.md).
@@ -24,7 +24,7 @@ The easiest way to install and run Freqtrade is to clone the bot Github reposito
The `stable` branch contains the code of the last release (done usually once per month on an approximately one week old snapshot of the `develop` branch to prevent packaging bugs, so potentially it's more stable).
!!! Note
Python3.7 or higher and the corresponding `pip` are assumed to be available. The install-script will warn you and stop if that's not the case. `git` is also needed to clone the Freqtrade repository.
Python3.8 or higher and the corresponding `pip` are assumed to be available. The install-script will warn you and stop if that's not the case. `git` is also needed to clone the Freqtrade repository.
Also, python headers (`python<yourversion>-dev` / `python<yourversion>-devel`) must be available for the installation to complete successfully.
!!! Warning "Up-to-date clock"
@@ -36,13 +36,17 @@ The easiest way to install and run Freqtrade is to clone the bot Github reposito
These requirements apply to both [Script Installation](#script-installation) and [Manual Installation](#manual-installation).
!!! Note "ARM64 systems"
If you are running an ARM64 system (like a MacOS M1 or an Oracle VM), please use [docker](docker_quickstart.md) to run freqtrade.
While native installation is possible with some manual effort, this is not supported at the moment.
sudo echo "[global]\nextra-index-url=https://www.piwheels.org/simple" > tee /etc/pip.conf
@@ -113,6 +117,13 @@ git checkout develop
You may later switch between branches at any time with the `git checkout stable`/`git checkout develop` commands.
??? Note "Install from pypi"
An alternative way to install Freqtrade is from [pypi](https://pypi.org/project/freqtrade/). The downside is that this method requires ta-lib to be correctly installed beforehand, and is therefore currently not the recommended way to install Freqtrade.
``` bash
pip install freqtrade
```
------
## Script Installation
@@ -132,11 +143,11 @@ If you are on Debian, Ubuntu or MacOS, freqtrade provides the script to install
### Activate your virtual environment
Each time you open a new terminal, you must run `source .env/bin/activate` to activate your virtual environment.
Each time you open a new terminal, you must run `source .venv/bin/activate` to activate your virtual environment.
```bash
# then activate your .env
source ./.env/bin/activate
# activate virtual environment
source ./.venv/bin/activate
```
### Congratulations
@@ -158,10 +169,10 @@ You can as well update, configure and reset the codebase of your bot with `./scr
** --install **
With this option, the script will install the bot and most dependencies:
You will need to have git and python3.7+ installed beforehand for this to work.
You will need to have git and python3.8+ installed beforehand for this to work.
* Mandatory software as: `ta-lib`
* Setup your virtualenv under `.env/`
* Setup your virtualenv under `.venv/`
This option is a combination of installation tasks and `--reset`
@@ -391,8 +411,8 @@ If you used (1)`Script` or (2)`Manual` installation, you need to run the bot in
# if:
bash: freqtrade: command not found
# then activate your .env
source ./.env/bin/activate
# then activate your virtual environment
source ./.venv/bin/activate
```
### MacOS installation error
@@ -407,16 +427,3 @@ open /Library/Developer/CommandLineTools/Packages/macOS_SDK_headers_for_macOS_10
```
If this file is inexistent, then you're probably on a different version of MacOS, so you may need to consult the internet for specific resolution details.
### MacOS installation error with python 3.9
When using python 3.9 on macOS, it's currently necessary to install some os-level modules to allow dependencies to compile.
The errors you'll see happen during installation and are related to the installation of `tables` or `blosc`.
You can install the necessary libraries with the following command:
```bash
brew install hdf5 c-blosc
```
After this, please run the installation (script) again.
This feature is still in it's testing phase. Should you notice something you think is wrong please let us know via Discord or via Github Issue.
!!! Note "Multiple bots on one account"
You can't run 2 bots on the same account with leverage. For leveraged / margin trading, freqtrade assumes it's the only user of the account, and all liquidation levels are calculated based on this assumption.
!!! Danger "Trading with leverage is very risky"
Do not trade with a leverage > 1 using a strategy that hasn't shown positive results in a live run using the spot market. Check the stoploss of your strategy. With a leverage of 2, a stoploss of 0.5 (50%) would be too low, and these trades would be liquidated before reaching that stoploss.
We do not assume any responsibility for eventual losses that occur from using this software or this mode.
Please only use advanced trading modes when you know how freqtrade (and your strategy) works.
Also, never risk more than what you can afford to lose.
If you already have an existing strategy, please read the [strategy migration guide](strategy_migration.md#strategy-migration-between-v2-and-v3) to migrate your strategy from a freqtrade v2 strategy, to strategy of version 3 which can short and trade futures.
## Shorting
Shorting is not possible when trading with [`trading_mode`](#understand-tradingmode) set to `spot`. To short trade, `trading_mode` must be set to `margin`(currently unavailable) or [`futures`](#futures), with [`margin_mode`](#margin-mode) set to `cross`(currently unavailable) or [`isolated`](#isolated-margin-mode)
For a strategy to short, the strategy class must set the class variable `can_short = True`
Please read [strategy customization](strategy-customization.md#entry-signal-rules) for instructions on how to set signals to enter and exit short trades.
## Understand `trading_mode`
The possible values are: `spot` (default), `margin`(*Currently unavailable*) or `futures`.
### Spot
Regular trading mode (low risk)
- Long trades only (No short trades).
- No leverage.
- No Liquidation.
- Profits gained/lost are equal to the change in value of the assets (minus trading fees).
### Leverage trading modes
With leverage, a trader borrows capital from the exchange. The capital must be re-payed fully to the exchange (potentially with interest), and the trader keeps any profits, or pays any losses, from any trades made using the borrowed capital.
Because the capital must always be re-payed, exchanges will **liquidate** (forcefully sell the traders assets) a trade made using borrowed capital when the total value of assets in the leverage account drops to a certain point (a point where the total value of losses is less than the value of the collateral that the trader actually owns in the leverage account), in order to ensure that the trader has enough capital to pay the borrowed assets back to the exchange. The exchange will also charge a **liquidation fee**, adding to the traders losses.
For this reason, **DO NOT TRADE WITH LEVERAGE IF YOU DON'T KNOW EXACTLY WHAT YOUR DOING. LEVERAGE TRADING IS HIGH RISK, AND CAN RESULT IN THE VALUE OF YOUR ASSETS DROPPING TO 0 VERY QUICKLY, WITH NO CHANCE OF INCREASING IN VALUE AGAIN.**
#### Margin (currently unavailable)
Trading occurs on the spot market, but the exchange lends currency to you in an amount equal to the chosen leverage. You pay the amount lent to you back to the exchange with interest, and your profits/losses are multiplied by the leverage specified.
#### Futures
Perpetual swaps (also known as Perpetual Futures) are contracts traded at a price that is closely tied to the underlying asset they are based off of (ex.). You are not trading the actual asset but instead are trading a derivative contract. Perpetual swap contracts can last indefinitely, in contrast to futures or option contracts.
In addition to the gains/losses from the change in price of the futures contract, traders also exchange _funding fees_, which are gains/losses worth an amount that is derived from the difference in price between the futures contract and the underlying asset. The difference in price between a futures contract and the underlying asset varies between exchanges.
To trade in futures markets, you'll have to set `trading_mode` to "futures".
You will also have to pick a "margin mode" (explanation below) - with freqtrade currently only supporting isolated margin.
``` json
"trading_mode": "futures",
"margin_mode": "isolated"
```
##### Pair namings
Freqtrade follows the [ccxt naming conventions for futures](https://docs.ccxt.com/#/README?id=perpetual-swap-perpetual-future).
A futures pair will therefore have the naming of `base/quote:settle` (e.g. `ETH/USDT:USDT`).
### Margin mode
On top of `trading_mode` - you will also have to configure your `margin_mode`.
While freqtrade currently only supports one margin mode, this will change, and by configuring it now you're all set for future updates.
The possible values are: `isolated`, or `cross`(*currently unavailable*).
#### Isolated margin mode
Each market(trading pair), keeps collateral in a separate account
``` json
"margin_mode": "isolated"
```
#### Cross margin mode (currently unavailable)
One account is used to share collateral between markets (trading pairs). Margin is taken from total account balance to avoid liquidation when needed.
``` json
"margin_mode": "cross"
```
Please read the [exchange specific notes](exchanges.md) for exchanges that support this mode and how they differ.
## Set leverage to use
Different strategies and risk profiles will require different levels of leverage.
While you could configure one static leverage value - freqtrade offers you the flexibility to adjust this via [strategy leverage callback](strategy-callbacks.md#leverage-callback) - which allows you to use different leverages by pair, or based on some other factor benefitting your strategy result.
If not implemented, leverage defaults to 1x (no leverage).
!!! Warning
Higher leverage also equals higher risk - be sure you fully understand the implications of using leverage!
## Understand `liquidation_buffer`
*Defaults to `0.05`*
A ratio specifying how large of a safety net to place between the liquidation price and the stoploss to prevent a position from reaching the liquidation price.
This artificial liquidation price is calculated as:
Possible values are any floats between 0.0 and 0.99
**ex:** If a trade is entered at a price of 10 coin/USDT, and the liquidation price of this trade is 8 coin/USDT, then with `liquidation_buffer` set to `0.05` the minimum stoploss for this trade would be $8 + ((10 - 8) * 0.05) = 8 + 0.1 = 8.1$
!!! Danger "A `liquidation_buffer` of 0.0, or a low `liquidation_buffer` is likely to result in liquidations, and liquidation fees"
Currently Freqtrade is able to calculate liquidation prices, but does not calculate liquidation fees. Setting your `liquidation_buffer` to 0.0, or using a low `liquidation_buffer` could result in your positions being liquidated. Freqtrade does not track liquidation fees, so liquidations will result in inaccurate profit/loss results for your bot. If you use a low `liquidation_buffer`, it is recommended to use `stoploss_on_exchange` if your exchange supports this.
## Unavailable funding rates
For futures data, exchanges commonly provide the futures candles, the marks, and the funding rates. However, it is common that whilst candles and marks might be available, the funding rates are not. This can affect backtesting timeranges, i.e. you may only be able to test recent timeranges and not earlier, experiencing the `No data found. Terminating.` error. To get around this, add the `futures_funding_rate` config option as listed in [configuration.md](configuration.md), and it is recommended that you set this to `0`, unless you know a given specific funding rate for your pair, exchange and timerange. Setting this to anything other than `0` can have drastic effects on your profit calculations within strategy, e.g. within the `custom_exit`, `custom_stoploss`, etc functions.
!!! Warning "This will mean your backtests are inaccurate."
This will not overwrite funding rates that are available from the exchange, but bear in mind that setting a false funding rate will mean backtesting results will be inaccurate for historical timeranges where funding rates are not available.
### Developer
#### Margin mode
For shorts, the currency which pays the interest fee for the `borrowed` currency is purchased at the same time of the closing trade (This means that the amount purchased in short closing trades is greater than the amount sold in short opening trades).
For longs, the currency which pays the interest fee for the `borrowed` will already be owned by the user and does not need to be purchased. The interest is subtracted from the `close_value` of the trade.
All Fees are included in `current_profit` calculations during the trade.
#### Futures mode
Funding fees are either added or subtracted from the total amount of a trade
Use this csv-filename to store lookahead-analysis-
results
```
!!! Note ""
The above Output was reduced to options `lookahead-analysis` adds on top of regular backtesting commands.
### Summary
Checks a given strategy for look ahead bias via lookahead-analysis
Look ahead bias means that the backtest uses data from future candles thereby not making it viable beyond backtesting
and producing false hopes for the one backtesting.
### Introduction
Many strategies - without the programmer knowing - have fallen prey to look ahead bias.
Any backtest will populate the full dataframe including all time stamps at the beginning.
If the programmer is not careful or oblivious how things work internally
(which sometimes can be really hard to find out) then it will just look into the future making the strategy amazing
but not realistic.
This command is made to try to verify the validity in the form of the aforementioned look ahead bias.
### How does the command work?
It will start with a backtest of all pairs to generate a baseline for indicators and entries/exits.
After the backtest ran, it will look if the `minimum-trade-amount` is met
and if not cancel the lookahead-analysis for this strategy.
After setting the baseline it will then do additional runs for every entry and exit separately.
When a verification-backtest is done, it will compare the indicators as the signal (either entry or exit) and report the bias.
After all signals have been verified or falsified a result-table will be generated for the user to see.
### Caveats
-`lookahead-analysis` can only verify / falsify the trades it calculated and verified.
If the strategy has many different signals / signal types, it's up to you to select appropriate parameters to ensure that all signals have triggered at least once. Not triggered signals will not have been verified.
This could lead to a false-negative (the strategy will then be reported as non-biased).
-`lookahead-analysis` has access to everything that backtesting has too.
Please don't provoke any configs like enabling position stacking.
If you decide to do so, then make doubly sure that you won't ever run out of `max_open_trades` amount and neither leftover money in your wallet.
The `-p/--pairs` argument can be used to specify pairs you would like to plot.
@@ -107,9 +107,6 @@ The `-p/--pairs` argument can be used to specify pairs you would like to plot.
Specify custom indicators.
Use `--indicators1` for the main plot and `--indicators2` for the subplot below (if values are in a different range than prices).
!!! Tip
You will almost certainly want to specify a custom strategy! This can be done by adding `-s Classname` / `--strategy ClassName` to the command.
``` bash
freqtrade plot-dataframe --strategy AwesomeStrategy -p BTC/ETH --indicators1 sma ema --indicators2 macd
```
@@ -164,16 +161,17 @@ The resulting plot will have the following elements:
An advanced plot configuration can be specified in the strategy in the `plot_config` parameter.
Additional features when using plot_config include:
Additional features when using `plot_config` include:
* Specify colors per indicator
* Specify additional subplots
* Specify indicator pairs to fill area in between
* Specify indicator pairs to fill area in between
The sample plot configuration below specifies fixed colors for the indicators. Otherwise, consecutive plots may produce different color schemes each time, making comparisons difficult.
It also allows multiple subplots to display both MACD and RSI at the same time.
Plot type can be configured using `type` key. Possible types are:
* `scatter` corresponding to `plotly.graph_objects.Scatter` class (default).
* `bar` corresponding to `plotly.graph_objects.Bar` class.
@@ -182,40 +180,89 @@ Extra parameters to `plotly.graph_objects.*` constructor can be specified in `pl
Sample configuration with inline comments explaining the process:
``` python
plot_config = {
'main_plot': {
# Configuration for main plot indicators.
# Specifies `ema10` to be red, and `ema50` to be a shade of gray
'ema10': {'color': 'red'},
'ema50': {'color': '#CCCCCC'},
# By omitting color, a random color is selected.
'sar': {},
# fill area between senkou_a and senkou_b
'senkou_a': {
'color': 'green', #optional
'fill_to': 'senkou_b',
'fill_label': 'Ichimoku Cloud', #optional
'fill_color': 'rgba(255,76,46,0.2)', #optional
},
# plot senkou_b, too. Not only the area to it.
'senkou_b': {}
@property
def plot_config(self):
"""
There are a lot of solutions how to build the return dictionary.
The only important point is the return value.
Example:
plot_config = {'main_plot': {}, 'subplots': {}}
"""
plot_config = {}
plot_config['main_plot'] = {
# Configuration for main plot indicators.
# Assumes 2 parameters, emashort and emalong to be specified.
The above configuration assumes that `ema10`, `ema50`, `senkou_a`, `senkou_b`,
`macd`, `macdsignal`, `macdhist` and `rsi` are columns in the DataFrame created by the strategy.
@@ -223,6 +270,9 @@ Sample configuration with inline comments explaining the process:
!!! Warning
`plotly` arguments are only supported with plotly library and will not work with freq-ui.
!!! Note "Trade position adjustments"
If `position_adjustment_enable` / `adjust_trade_position()` is used, the trade initial buy price is averaged over multiple orders and the trade start price will most likely appear outside the candle range.
## Plot profit

@@ -233,6 +283,8 @@ The `plot-profit` subcommand shows an interactive graph with three plots:
* The summarized profit made by backtesting.
Note that this is not the real-world profit, but more of an estimate.
* Profit for each individual pair.
* Parallelism of trades.
* Underwater (Periods of drawdown).
The first graph is good to get a grip of how the overall market progresses.
@@ -242,6 +294,8 @@ This graph will also highlight the start (and end) of the Max drawdown period.
The third graph can be useful to spot outliers, events in pairs that cause profit spikes.
The forth graph can help you analyze trade parallelism, showing how often max_open_trades have been maxed out.
Possible options for the `freqtrade plot-profit` subcommand:
freqtrade provides a mechanism whereby an instance (also called `consumer`) may listen to messages from an upstream freqtrade instance (also called `producer`) using the message websocket. Mainly, `analyzed_df` and `whitelist` messages. This allows the reuse of computed indicators (and signals) for pairs in multiple bots without needing to compute them multiple times.
See [Message Websocket](rest-api.md#message-websocket) in the Rest API docs for setting up the `api_server` configuration for your message websocket (this will be your producer).
!!! Note
We strongly recommend to set `ws_token` to something random and known only to yourself to avoid unauthorized access to your bot.
## Configuration
Enable subscribing to an instance by adding the `external_message_consumer` section to the consumer's config file.
```json
{
//...
"external_message_consumer":{
"enabled":true,
"producers":[
{
"name":"default",// This can be any name you'd like, default is "default"
"host":"127.0.0.1",// The host from your producer's api_server config
"port":8080,// The port from your producer's api_server config
"secure":false,// Use a secure websockets connection, default false
"ws_token":"sercet_Ws_t0ken"// The ws_token from your producer's api_server config
}
],
// The following configurations are optional, and usually not required
// "wait_timeout": 300,
// "ping_timeout": 10,
// "sleep_time": 10,
// "remove_entry_exit_signals": false,
// "message_size_limit": 8
}
//...
}
```
| Parameter | Description |
|------------|-------------|
| `enabled` | **Required.** Enable consumer mode. If set to false, all other settings in this section are ignored.<br>*Defaults to `false`.*<br>**Datatype:** boolean .
| `producers` | **Required.** List of producers <br>**Datatype:** Array.
| `producers.name` | **Required.** Name of this producer. This name must be used in calls to `get_producer_pairs()` and `get_producer_df()` if more than one producer is used.<br>**Datatype:** string
| `producers.host` | **Required.** The hostname or IP address from your producer.<br>**Datatype:** string
| `producers.port` | **Required.** The port matching the above host.<br>*Defaults to `8080`.*<br>**Datatype:** Integer
| `producers.secure` | **Optional.** Use ssl in websockets connection. Default False.<br>**Datatype:** string
| `producers.ws_token` | **Required.**`ws_token` as configured on the producer.<br>**Datatype:** string
| | **Optional settings**
| `wait_timeout` | Timeout until we ping again if no message is received. <br>*Defaults to `300`.*<br>**Datatype:** Integer - in seconds.
| `ping_timeout` | Ping timeout <br>*Defaults to `10`.*<br>**Datatype:** Integer - in seconds.
| `sleep_time` | Sleep time before retrying to connect.<br>*Defaults to `10`.*<br>**Datatype:** Integer - in seconds.
| `remove_entry_exit_signals` | Remove signal columns from the dataframe (set them to 0) on dataframe receipt.<br>*Defaults to `false`.*<br>**Datatype:** Boolean.
| `message_size_limit` | Size limit per message<br>*Defaults to `8`.*<br>**Datatype:** Integer - Megabytes.
Instead of (or as well as) calculating indicators in `populate_indicators()` the follower instance listens on the connection to a producer instance's messages (or multiple producer instances in advanced configurations) and requests the producer's most recently analyzed dataframes for each pair in the active whitelist.
A consumer instance will then have a full copy of the analyzed dataframes without the need to calculate them itself.
## Examples
### Example - Producer Strategy
A simple strategy with multiple indicators. No special considerations are required in the strategy itself.
You can use this to setup [FreqAI](freqai.md) on a powerful machine, while you run consumers on simple machines like raspberries, which can interpret the signals generated from the producer in different ways.
### Example - Consumer Strategy
A logically equivalent strategy which calculates no indicators itself, but will have the same analyzed dataframes available to make trading decisions based on the indicators calculated in the producer. In this example the consumer has the same entry criteria, however this is not necessary. The consumer may use different logic to enter/exit trades, and only use the indicators as specified.
```py
classConsumerStrategy(IStrategy):
#...
process_only_new_candles=False# required for consumers
By setting `remove_entry_exit_signals=false`, you can also use the producer's signals directly. They should be available as `enter_long_default` (assuming `suffix="default"` was used) - and can be used as either signal directly, or as additional indicator.
Some files were not shown because too many files have changed in this diff
Show More
Reference in New Issue
Block a user
Blocking a user prevents them from interacting with repositories, such as opening or commenting on pull requests or issues. Learn more about blocking a user.